If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: AFALQALPAMCDVYVPPHCPVATAPLGGF
Peptide within the protein Oat-gluten-P80356:
MKTFLIFALLAMAATMATAQFDPSEQYQPYPEQQQPILQQQQMLLQQQQQMLLQQQPLLQVLQQQLNPCRQFLVQQCSPVAVVPFLRSQILQQSSCQVMRQQCCRQLEQIPEQLRCPAIHSVVQAIIMQQQQFFQPQMQQQFFQPQMQQVTQGIFQPQMQQVTQGIFQPQLQQVTQGIFQPQMQGQIEGMRAFALQALPAMCDVYVPPHCPVATAPLGGF
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide AFALQALPAMCDVYVPPHCPVATAPLGGF are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Avena sativa | Oat | AAB32025 ABD14148 P80356 |
4498 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.