If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SQILQQSSCQVMR
Peptide within the protein Oat-gluten-P80356:
MKTFLIFALLAMAATMATAQFDPSEQYQPYPEQQQPILQQQQMLLQQQQQMLLQQQPLLQVLQQQLNPCRQFLVQQCSPVAVVPFLRSQILQQSSCQVMRQQCCRQLEQIPEQLRCPAIHSVVQAIIMQQQQFFQPQMQQQFFQPQMQQVTQGIFQPQMQQVTQGIFQPQLQQVTQGIFQPQMQGQIEGMRAFALQALPAMCDVYVPPHCPVATAPLGGF
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide SQILQQSSCQVMR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Avena canariensis | Avena canariensis | CCC80642 |
146532 |
| Avena clauda | Avena clauda | CCC80657 |
83523 |
| Avena damascena | Avena damascena | CCC80649 |
283873 |
| Avena eriantha | Avena eriantha | CCC80656 |
146534 |
| Avena insularis | Avena insularis | CCC80666 |
283872 |
| Avena longiglumis | Avena longiglumis | CCC80654 |
4500 |
| Avena macrostachya | Avena macrostachya | CCC80666 |
106814 |
| Avena magna | Avena magna | CCC80666 CCC80670 |
283874 |
| Avena murphyi | Avena murphyi | CCC80674 CCC80670 |
37663 |
| Avena prostrata | Avena prostrata | CCC80655 CCC80641 |
279683 |
| Avena sativa | Oat | CBL51491 CBL51487 AAB32025 CBL51490 AAA32721 AGB56875 AGB56864 AGB56862 ABD14148 AGB56874 CBL51495 P80356 AGB56873 |
4498 |
| Avena ventricosa | Avena ventricosa | CCC80674 |
146535 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.