If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: QFLVQQCSPVAAVPFLR
Peptide within the protein Oat-gluten-Q09072:
MKTFLIIALLAMAVATATATTTVQYNPSEQYQPYPEQQEPFVQQQQPFVQQQQPFVQQQQMFLQPLLQQQLNPCKQFLVQQCSPVAAVPFLRSQILRQAICQVTRQQCCRQLAQIPEQLRCPAIHSVVQSIILQQQQQQQQFIQPQLQQQVFQPQLQLQQQVFQPQLQQQVFQPQLQQVFNQPQMQGQIEGMRAFALQALPAMCDVYVPPQCPVATAPLGGF
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide QFLVQQCSPVAAVPFLR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Avena insularis | Avena insularis | CCC80676 |
283872 |
| Avena canariensis | Avena canariensis | CCC80647 |
146532 |
| Avena longiglumis | Avena longiglumis | CCC80651 CCC80643 |
4500 |
| Avena magna | Avena magna | CCC80670 |
283874 |
| Avena murphyi | Avena murphyi | CCC80674 CCC80670 CCC80672 |
37663 |
| Avena prostrata | Avena prostrata | CCC80650 |
279683 |
| Avena sativa | Oat | AGB56874 AAA32716 CBL51496 AGB56857 |
4498 |
| Avena strigosa | Black oat | CCC80653 CCC80651 CCC80647 |
38783 |
| Avena ventricosa | Avena ventricosa | CCC80674 |
146535 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.