If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: QAICQVAR
Peptide within the protein Oat-gluten-Q09114:
TTTVQYNPSEQYQPYPEQQEPFVQQQPFVQQQQQPFVQQQQMFLQPLLQQQLNPCKQFLVQQCSPVAVVPFLRSQILRQAICQVARQQCCRQLAQIPEQLRCPAIHSVVQAIILQQQQQQQFFQPQLQQQVFQPQLQQVFNQPQQQAQFEGMRAFALQALPAMCDVYVPPQCPVATAPLGGF
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide QAICQVAR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Avena clauda | Avena clauda | CCC80661 CCC80659 |
83523 |
| Avena eriantha | Avena eriantha | CCC80659 |
146534 |
| Avena macrostachya | Avena macrostachya | CCC80677 |
106814 |
| Avena murphyi | Avena murphyi | CCC80673 |
37663 |
| Avena sativa | Oat | Q09114 AGB56876 AGB56870 AGB56866 AGB56877 AGB56872 AGB56868 CBL51488 AGB56858 |
4498 |
| Avena ventricosa | Avena ventricosa | CCC80661 |
146535 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.