If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: QFLVQQCSPVAVVPFLR
Peptide within the protein Oat-gluten-Q09114:
TTTVQYNPSEQYQPYPEQQEPFVQQQPFVQQQQQPFVQQQQMFLQPLLQQQLNPCKQFLVQQCSPVAVVPFLRSQILRQAICQVARQQCCRQLAQIPEQLRCPAIHSVVQAIILQQQQQQQFFQPQLQQQVFQPQLQQVFNQPQQQAQFEGMRAFALQALPAMCDVYVPPQCPVATAPLGGF
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide QFLVQQCSPVAVVPFLR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Avena canariensis | Avena canariensis | CCC80642 CCC80642 |
146532 |
| Avena clauda | Avena clauda | CCC80661 CCC80659 CCC80661 CCC80659 |
83523 |
| Avena damascena | Avena damascena | CCC80649 CCC80649 |
283873 |
| Avena eriantha | Avena eriantha | CCC80659 CCC80659 |
146534 |
| Avena insularis | Avena insularis | CCC80666 CCC80666 |
283872 |
| Avena longiglumis | Avena longiglumis | CCC80654 CCC80654 |
4500 |
| Avena macrostachya | Avena macrostachya | CCC80666 CCC80677 CCC80666 CCC80677 |
106814 |
| Avena magna | Avena magna | CCC80666 CCC80666 |
283874 |
| Avena murphyi | Avena murphyi | CCC80673 CCC80673 |
37663 |
| Avena prostrata | Avena prostrata | CCC80655 CCC80641 CCC80655 CCC80641 |
279683 |
| Avena sativa | Oat | Q09114 AGB56876 AGB56870 AGB56866 AGB56877 AAB32025 CBL51490 AGB56872 AGB56862 ABD14148 AGB56868 CBL51495 P80356 CBL51488 AGB56858 AGB56873 AGB56859 Q09114 AGB56876 AGB56870 AGB56866 AGB56877 AAB32025 CBL51490 AGB56872 AGB56862 ABD14148 AGB56868 CBL51495 P80356 CBL51488 AGB56858 AGB56873 AGB56859 |
4498 |
| Avena ventricosa | Avena ventricosa | CCC80661 CCC80661 |
146535 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.