If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: LFLQNFSATAR
Peptide within the protein Seb-m-1:
Isoform: Seb-m-1.0101
MALAASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIEEEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVKG
Isoform: Seb-m-1.0201
MAFASVGLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFIEEEELKLFLQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVKQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide LFLQNFSATAR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Neolamprologus brichardi | Neolamprologus brichardi | XP_006791597 |
32507 |
| Sebastes marinus | Ocean perch | CBA35347 CAQ72968 |
34821 |
| Siniperca chuatsi | Mandarin fish | ADA70321 |
119488 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.