If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: LFLQTFK
Peptide within the protein Seb-m-1:
Isoform: Seb-m-1.0101
MALAASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIEEEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVKG
Isoform: Seb-m-1.0201
MAFASVGLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFIEEEELKLFLQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVKQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide LFLQTFK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Anopheles darlingi | Anopheles darlingi | ETN62036 |
43151 |
| Clupea harengus | Atlantic herring | XP_012694367 XP_012694366 |
7950 |
| Cyphomyrmex costatus | Cyphomyrmex costatus | KYM97480 |
456900 |
| Dictyostelium lacteum | Dictyostelium lacteum | KYQ88628 |
361077 |
| Fomitiporia mediterranea MF3/22 | Fomitiporia mediterranea mf3/22 | XP_007261985 |
694068 |
| Notothenia coriiceps | Black rockcod | XP_010770130 |
8208 |
| Phaeodactylum tricornutum CCAP 1055/1 | Phaeodactylum tricornutum ccap 1055/1 | XP_002185227 |
556484 |
| Prunus mume | Japanese apricot | XP_008234976 |
102107 |
| Sebastes marinus | Ocean perch | CAQ72969 |
34821 |
| Struthio camelus australis | Struthio camelus australis | KFV85439 |
441894 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.