If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: AADSFDHK
Peptide within the protein Sar-sa-1:
MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVKH
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide AADSFDHK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aotus nancymaae | Ma's night monkey | XP_002743782 XP_012331789 |
37293 |
| Austrofundulus limnaeus | Austrofundulus limnaeus | XP_013862405 |
52670 |
| Callithrix jacchus | White-tufted-ear marmoset | XP_009008492 XP_002743782 |
9483 |
| Carlito syrichta | Philippine tarsier | XP_008054473 |
1868482 |
| Cebus capucinus imitator | Cebus capucinus imitator | XP_017374528 XP_017374525 XP_017374522 |
1737458 |
| Chinchilla lanigera | Long-tailed chinchilla | XP_005379226 |
34839 |
| Cricetulus griseus | Chinese hamster | EGW09990 ERE84432 XP_007652928 |
10029 |
| Cynoglossus semilaevis | Tongue sole | XP_008328383 |
244447 |
| Cyprinus carpio | Common carp | KTG01350 |
7962 |
| Danio rerio | Zebrafish | CAK10746 NP_991137 AAO33398 |
7955 |
| Echinops telfairi | Small madagascar hedgehog | XP_004700363 |
9371 |
| Elephantulus edwardii | Cape elephant shrew | XP_006890217 |
28737 |
| Epinephelus coioides | Orange-spotted grouper | ADE09346 |
94232 |
| Galeopterus variegatus | Sunda flying lemur | XP_008588862 |
482537 |
| Gerbillinae | Gerbils | S27208 |
10045 |
| Gerbillus sp. | Gerbillus sp. | P80080 |
10187 |
| Ictalurus punctatus | Channel catfish | XP_017312511 NP_001187453 |
7998 |
| Manis javanica | Malayan pangolin | XP_017496677 XP_017496676 |
9974 |
| Meriones unguiculatus | Mongolian gerbil | S27208 |
10047 |
| Mesocricetus auratus | Golden hamster | XP_012966510 |
10036 |
| Microcebus murinus | Gray mouse lemur | XP_012642567 |
30608 |
| Microtus ochrogaster | Prairie vole | XP_005354310 |
79684 |
| Mus musculus | House mouse | AAB33066 NP_038673 CAA38434 EDL29665 |
10090 |
| Mus sp. | Mus sp. | AAB33066 |
10095 |
| Notothenia coriiceps | Black rockcod | XP_010770130 XP_010770129 |
8208 |
| Octodon degus | Degu | XP_004634638 |
10160 |
| Oncorhynchus mykiss | Rainbow trout | CDQ72164 CDQ84397 |
8022 |
| Otolemur garnettii | Small-eared galago | XP_003783297 |
30611 |
| Peromyscus maniculatus bairdii | Prairie deer mouse | XP_006991962 |
230844 |
| Pteropus alecto | Black flying fox | XP_006914542 ELK10266 |
9402 |
| Pteropus vampyrus | Large flying fox | XP_006914542 |
132908 |
| Pygocentrus nattereri | Red-bellied piranha | XP_017539868 |
42514 |
| Rattus norvegicus | Norway rat | 1XVJ_A 1S3P_A 1RTP_1 3F45_A NP_071944 EDM15887 |
10116 |
| Rattus rattus | Black rat | 1RTP_1 |
10117 |
| Rousettus aegyptiacus | Egyptian rousette | XP_016017321 |
9407 |
| Saimiri boliviensis boliviensis | Bolivian squirrel monkey | XP_002743782 |
39432 |
| Salmo salar | Atlantic salmon | XP_014059854 NP_001167235 XP_014059853 XP_014059852 |
8030 |
| Sardinops melanostictus | Sardinops melanostictus | BAF98921 |
41697 |
| Sardinops sagax | South american pilchard | CAQ68366 |
28381 |
| Sinocyclocheilus anshuiensis | Sinocyclocheilus anshuiensis | XP_016362993 XP_016098921 |
1608454 |
| Sinocyclocheilus grahami | Sinocyclocheilus grahami | XP_016098921 XP_016150725 XP_016098920 |
75366 |
| Sinocyclocheilus rhinocerous | Sinocyclocheilus rhinocerous | XP_016379975 XP_016098921 |
307959 |
| Tupaia chinensis | Chinese tree shrew | XP_006156583 ELW52378 ELW52378 |
246437 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.