If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: LFLQNFCK
Peptide within the protein Sar-sa-1:
MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVKH
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Fish | Clu-h-1.0301 | 7950 |
| Fish | Sar-sa-1.0101 | 28381 |
Species containing the peptide LFLQNFCK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Clupea harengus | Atlantic herring | XP_012681238 CBA35352 NP_001296768 XP_012681238 CBA35352 NP_001296768 |
7950 |
| Sardinops melanostictus | Sardinops melanostictus | BAF98921 BAF98921 |
41697 |
| Sardinops sagax | South american pilchard | CAQ68366 CAQ68366 |
28381 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.