If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: ECGISSR
Peptide within the protein Car-i-1:
MARVAALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGESCREQIQRQQYLNRCQDYLRQQCRSGGYDEDNQRQHFRQCCQQLSQMEEQCQCEGLRQAVRQQQQEEGIRGEEMEEMVQCASDLPKECGISSRSCEIRRSWF
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide ECGISSR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Acromyrmex echinatior | Panamanian leafcutter ant | EGI63685 XP_011057380 XP_011057378 XP_011057381 |
103372 |
| Carya illinoinensis | Carya illinoinensis | AAO32314 |
32201 |
| Cyphomyrmex costatus | Cyphomyrmex costatus | KYM99953 |
456900 |
| Leptomonas pyrrhocoris | Leptomonas pyrrhocoris | XP_015660763 |
157538 |
| Trachymyrmex cornetzi | Trachymyrmex cornetzi | KYN22895 KYN22895 |
471704 |
| Trachymyrmex septentrionalis | Trachymyrmex septentrionalis | KYN39366 |
34720 |
| Trachymyrmex zeteki | Trachymyrmex zeteki | KYQ47075 |
64791 |
| Wuchereria bancrofti | Wuchereria bancrofti | EJW83930 |
6293 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.