If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: QQQQEEGIR
Peptide within the protein Car-i-1:
MARVAALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGESCREQIQRQQYLNRCQDYLRQQCRSGGYDEDNQRQHFRQCCQQLSQMEEQCQCEGLRQAVRQQQQEEGIRGEEMEEMVQCASDLPKECGISSRSCEIRRSWF
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide QQQQEEGIR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Carya illinoinensis | Carya illinoinensis | AAO32314 |
32201 |
| Eimeria brunetti | Eimeria brunetti | CDJ50174 |
51314 |
| Eimeria mitis | Eimeria mitis | XP_013350041 |
44415 |
| Eimeria praecox | Eimeria praecox | CDI83221 |
51316 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.