If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: QFEEQQK
Peptide within the protein Pis-v-1:
MAKLVLLLSAFAFLILAANASIYRATVEVEGENLSSGQSCQKQFEEQQKFKHCQMYVQQEVQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQFRGEKLQELYETASELPRMCNISPSQGCQFSSPYWSY
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide QFEEQQK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Anopheles darlingi | Anopheles darlingi | ETN63320 |
43151 |
| Ceratitis capitata | Mediterranean fruit fly | XP_012163052 |
7213 |
| Chrysochloris asiatica | Cape golden mole | XP_006831603 |
185453 |
| Dirofilaria immitis | Dog heartworm nematode | ALI16773 ALI16772 |
6287 |
| Gorilla gorilla gorilla | Western lowland gorilla | XP_004048369 |
9595 |
| Homo sapiens | Human | CAH10534 Q9P1Z9 BAA96053 NP_065944 CAH18175 EAW58841 AAI44522 |
9606 |
| Hyalella azteca | Hyalella azteca | XP_018025224 |
294128 |
| Lucilia cuprina | Australian sheep blowfly | KNC34146 |
7375 |
| Neotoma lepida | Desert woodrat | OBS68920 |
56216 |
| Nomascus leucogenys | Northern white-cheeked gibbon | XP_004087092 |
61853 |
| Otolemur garnettii | Small-eared galago | XP_012657756 |
30611 |
| Pan paniscus | Pygmy chimpanzee | XP_014201701 XP_008972301 XP_014201700 |
9597 |
| Pan troglodytes | Chimpanzee | XP_016816778 XP_016816780 XP_016816777 XP_520133 XP_016816776 XP_016816775 XP_016816774 XP_016816773 XP_016816771 XP_016816770 XP_016816769 XP_016816768 |
9598 |
| Peromyscus maniculatus bairdii | Prairie deer mouse | XP_006970774 |
230844 |
| Phytophthora sojae | Phytophthora sojae | XP_009521891 |
67593 |
| Pistacia vera | Pistacia vera | ABG73108 |
55513 |
| Pongo abelii | Sumatran orangutan | XP_002820057 |
9601 |
| Propithecus coquereli | Coquerel's sifaka | XP_012493713 |
379532 |
| Rhodosporidium toruloides | Rhodosporidium toruloides | XP_016272307 |
5286 |
| Rhodosporidium toruloides NP11 | Rhodosporidium toruloides np11 | XP_016272307 |
1130832 |
| Stomoxys calcitrans | Stable fly | XP_013098230 |
35570 |
| Stylonychia lemnae | Stylonychia lemnae | CDW76370 |
5949 |
| Theobroma cacao | Cacao | XP_007050624 EOX94781 |
3641 |
| Trichoderma harzianum | Trichoderma harzianum | KKP04977 |
5544 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.