If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: QQQQGQFR
Peptide within the protein Pis-v-1:
MAKLVLLLSAFAFLILAANASIYRATVEVEGENLSSGQSCQKQFEEQQKFKHCQMYVQQEVQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQFRGEKLQELYETASELPRMCNISPSQGCQFSSPYWSY
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide QQQQGQFR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Cryptococcus dejecticola CBS 10117 | Cryptococcus dejecticola cbs 10117 | OBR82129 |
1296121 |
| Cryptococcus pinus CBS 10737 | Cryptococcus pinus cbs 10737 | OCF46769 |
1296096 |
| Daphnia magna | Daphnia magna | JAN57875 KZS17916 JAN70362 |
35525 |
| Daphnia pulex | Common water flea | EFX85423 |
6669 |
| Drosophila navojoa | Drosophila navojoa | XP_017956194 |
7232 |
| Hanseniaspora valbyensis NRRL Y-1626 | Hanseniaspora valbyensis nrrl y-1626 | OBA26397 |
766949 |
| Hymenolepis microstoma | Hymenolepis microstoma | CDS26698 |
85433 |
| Kwoniella mangroviensis CBS 10435 | Kwoniella mangroviensis cbs 10435 | OCF58526 |
1331196 |
| Kwoniella mangroviensis CBS 8507 | Kwoniella mangroviensis cbs 8507 | OCF64180 |
1296122 |
| Kwoniella mangroviensis CBS 8886 | Kwoniella mangroviensis cbs 8886 | OCF64180 |
1296123 |
| Pistacia vera | Pistacia vera | ABG73108 |
55513 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.