If you found this site useful, please cite: Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Pistachio Protein: Pis v 3 | Vicillin

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 519 amino acids

KTDPELKQCKHQCKVQRQYDEEQKEQCAKGCEKYYKEKKGREQEEEEEEEWGSGRGRGDEFSTHEPGEKRLSQCMKQCERQDGGQQKQLCRFRCQEKYKKERREHSYSRDEEEEEEGDEEQEEEDENPYVFEDEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNHMDADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIVKLLQPVNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEKLFEKQDEGAIVKASKEQIRAMSRRGEGPSIWPFTGKSTGTFNLFKKDPSQSNNYGQLFESEFKDYPPLQELDIMVSYVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPHLSSSKNSGQEKSGPSYKKLSSSIRTDSVFVVPAGHPFVTVASGNQNLEILCFEVNAEGNIRYTLAGKKNIIEVMEKEAKELAFKTKGEEVDKVFGKQDEEFFFQGPKWRQHQQGRADE

UniProt: B4X640   IUIS: Pis v 3

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:
Peptide Characteristics:

Minimum length:

Maximum length:

1Peptide2Exp.3ESP4CONSeQ5
K LLQPVNLPGHYEVFHGPGGENPESFYR A 0 0.689 0.16616
K GGMSGPFYNSR A 0 0.508 0.38488
K QDEGAIVK A 0 0.242 0.54598
K DPSQSNNYGQLFESEFK D 0 0.727 0.47986
K NIIEVMEK E 0 0.237 0.4433
R QYDEEQK E 0 0.229 0.09048
K DYPPLQELDIMVSYVNITK G 0 0.745 0.1204
R LAFLVANPQAFVVPNHMDADSIFFVSWGR G 0 0.234 0.02188
R EQEEEEEEEWGSGR G 0 0.325 0.26662
K STGTFNLFK K 0 0.46 0.48454
K IAIVVSGEGR L 0 0.433 0.79146
R AGTPFYIVNTDENEK L 0 0.728 0.81198
R LEIACPHLSSSK N 0 0.608 0.63818
R QDGGQQK Q 0 0.202 0.08164
R GDEFSTHEPGEK R 0 0.498 0.16022
R GEGPSIWPFTGK S 0 0.57 0.53534
R EVLEAALK T 0 0.264 0.52418
R DEEEEEEGDEEQEEEDENPYVFEDEHFTTR V 0 0.457 0.33464
K QDEEFFFQGPK W 0 0.564 0.56712

1 Previous amino acid (^ = Start of protein)

2 Next amino acid ($ = End of protein)

3 Exp. = Number of publications in which this peptide has been reported experimentally

4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.