If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GDASAVVK
Peptide within the protein Pis-v-4:
MALLSYVTRKTLTESLRLGLKSHVRGLQTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQTYITNYNKALEQLDQAINKGDASAVVKLQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPPHGSLGWAIDTNFGSMEALIQRMNAEGAALQGSGWVWLGLDKESKKLVVETTANQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYAGELYQKECP
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide GDASAVVK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Brassica juncea | Brassica juncea | AEB00557 |
3707 |
| Brassica napus | Rape | CDY36283 |
3708 |
| Brassica rapa | Field mustard | ADR01111 XP_009122529 |
3711 |
| Camelina sativa | Camelina sativa | XP_010464784 XP_010490355 |
90675 |
| Capsella rubella | Capsella rubella | XP_006298472 |
81985 |
| Esox lucius | Northern pike | XP_012987499 |
8010 |
| Fragaria vesca subsp. vesca | Fragaria vesca subsp. vesca | XP_004307727 |
101020 |
| Fragaria x ananassa | Strawberry | AGI65627 |
3747 |
| Genlisea aurea | Genlisea aurea | EPS65962 |
192259 |
| Mimulus guttatus | Spotted monkey flower | XP_012858324 |
4155 |
| Pistacia vera | Pistacia vera | ABR29644 |
55513 |
| Raphanus sativus | Radish | AAC15806 AAL07333 |
3726 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.