If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GPSLVPLLGIDVWEHAYYLQYK
Peptide within the protein Pis-v-4:
MALLSYVTRKTLTESLRLGLKSHVRGLQTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQTYITNYNKALEQLDQAINKGDASAVVKLQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPPHGSLGWAIDTNFGSMEALIQRMNAEGAALQGSGWVWLGLDKESKKLVVETTANQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYAGELYQKECP
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide GPSLVPLLGIDVWEHAYYLQYK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Acanthus ebracteatus | Acanthus ebracteatus | ABK32075 |
241842 |
| Avicennia marina | Avicennia marina | AAN15216 |
82927 |
| Boea hygrometrica | Boea hygrometrica | KZV34922 |
472368 |
| Cicer arietinum | Chickpea | XP_004502849 |
3827 |
| Litchi chinensis | Litchi chinensis | AGA16522 AEK05514 |
151069 |
| Pistacia vera | Pistacia vera | ABR29644 |
55513 |
| Salicornia europaea | Salicornia europaea | AFD50703 |
206448 |
| Trifolium repens | White clover | AFV96160 |
3899 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.