If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: DFDEPGFLAPTGLFLGPTK
Peptide within the protein Ory-s-12:
MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGL
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide DFDEPGFLAPTGLFLGPTK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Cenchrus americanus | Cenchrus americanus | AGN33441 |
4543 |
| Cynodon dactylon | Bermuda grass | O04725 |
28909 |
| Olea europaea | Common olive | A4KA61 |
4146 |
| Oryza brachyantha | Malo sina | XP_006661691 XP_006661690 |
4533 |
| Oryza sativa | Rice | XP_015613779 |
4530 |
| Oryza sativa Indica Group | Long-grained rice | EEC66727 XP_015613779 |
39946 |
| Oryza sativa Japonica Group | Japanese rice | XP_015613779 |
39947 |
| Setaria italica | Foxtail millet | XP_004969894 KQL06902 |
4555 |
| Sorghum bicolor | Sorghum | XP_002456332 |
4558 |
| Zea mays | Zea mays | A4KA61 ABQ23999 NP_001105987 A4KA60 A4KA59 NP_001106002 NP_001288512 NP_001149484 DAA57720 |
4577 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.