If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: LGDYLVEQGL
Peptide within the protein Ory-s-12:
MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGL
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide LGDYLVEQGL are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Capsicum annuum | Capsicum annuum | AAR97869 XP_016537636 |
4072 |
| Cenchrus americanus | Cenchrus americanus | AGN33441 |
4543 |
| Cicer arietinum | Chickpea | XP_004503498 |
3827 |
| Corylus avellana | Corylus avellana | A4KA44 |
13451 |
| Arabis alpina | Gray rockcress | KFK40342 KFK29491 |
50452 |
| Beta vulgaris subsp. vulgaris | Sugar beet | XP_010688357 |
3555 |
| Daucus carota subsp. sativus | Daucus carota subsp. sativus | XP_017215151 KZM89290 |
79200 |
| Fragaria vesca subsp. vesca | Fragaria vesca subsp. vesca | XP_004291152 XP_004287490 |
101020 |
| Fragaria x ananassa | Strawberry | P0C0Y3 |
3747 |
| Glycine soja | Glycine soja | KHN16653 |
3848 |
| Lotus japonicus | Lotus japonicus | AFK47285 AFK47224 |
34305 |
| Malus domestica | Apple | XP_008337609 |
3750 |
| Mangifera indica | Mango | ABD62998 ABB76134 |
29780 |
| Medicago truncatula | Barrel medic | ACJ83967 AFK47485 AFK40156 XP_003630698 |
3880 |
| Morus notabilis | Morus notabilis | XP_010095450 |
981085 |
| Nelumbo nucifera | Nelumbo nucifera | XP_010267105 |
4432 |
| Nicotiana sylvestris | Wood tobacco | XP_009796122 |
4096 |
| Nicotiana tabacum | Common tobacco | XP_009796122 XP_009602785 |
4097 |
| Nicotiana tomentosiformis | Nicotiana tomentosiformis | XP_009602785 |
4098 |
| Olea europaea | Common olive | A4GDS6 |
4146 |
| Oryza brachyantha | Malo sina | XP_006661691 XP_006661690 |
4533 |
| Oryza sativa | Rice | XP_015613779 |
4530 |
| Oryza sativa Indica Group | Long-grained rice | EEC66727 XP_015613779 |
39946 |
| Oryza sativa Japonica Group | Japanese rice | XP_015613779 |
39947 |
| Prunus dulcis x Prunus persica | Prunus dulcis x prunus persica | XP_007202751 |
472390 |
| Prunus mume | Japanese apricot | XP_007202751 |
102107 |
| Prunus persica | Peach | Q8GT39 XP_007202751 |
3760 |
| Setaria italica | Foxtail millet | XP_004969894 KQL06902 |
4555 |
| Solanum tuberosum | Potato | NP_001275370 ABA81885 |
4113 |
| Sorghum bicolor | Sorghum | XP_002456332 |
4558 |
| Zea mays | Zea mays | ABQ23999 NP_001288512 NP_001105452 AFW85125 NP_001149484 DAA57720 |
4577 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.