If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: TGQALVVGIYDEPMTPGQCNMVVER
Peptide within the protein Ory-s-12:
MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGL
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide TGQALVVGIYDEPMTPGQCNMVVER are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Brachypodium distachyon | Brachypodium distachyon | XP_003569765 |
15368 |
| Cenchrus americanus | Cenchrus americanus | AGN33441 |
4543 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | BAK07752 |
112509 |
| Olea europaea | Common olive | A4KA49 A4KA51 A4KA52 A4KA53 A4KA50 A4GFC3 P0DKG1 A4GFC0 |
4146 |
| Oryza brachyantha | Malo sina | XP_006661691 XP_006661690 |
4533 |
| Oryza sativa | Rice | XP_015613779 |
4530 |
| Oryza sativa Indica Group | Long-grained rice | EEC66727 XP_015613779 |
39946 |
| Oryza sativa Japonica Group | Japanese rice | XP_015613779 |
39947 |
| Phleum pratense | Timothy grass | A4KA33 A4KA32 A4KA36 A4KA37 A4KA49 A4KA34 O24282 O24650 P35079 |
15957 |
| Zea mays | Zea mays | A4KA57 P35082 NP_001105451 |
4577 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.