Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: NVLLQQCSPVALVSSVR
Peptide within the protein Rye-gluten-E5KZQ0:
MKTLLMLAILAMATTIATANMQVNPSGQVQCPQQQPFPQPQQSSPQQPQQPFPQQSQQPFPQQPQQSSPQPQQPYPQQPFPQQPQQPYPQQPQQPFPQQPQQPYPQQPQQPFPQQPQQPVPQQPQQQFPQQPQQPVPQQPLQQFPQQPQQSFPQQPQQPVPQQPLQQFPQQPQQPFPQQPQQPVPQQSQQPFPQTQQPQQPFPQPQQPQQLFPQTQQSSPQQPQQVTSQPQQPFPQAQPPQQSSPQSQQPYPQEPQQLFPQSQQPQQPFPQPQQPQQPFPQPQTQQSIPQPQQPFPQPQQPFPQSQEPFPQVHQPQQPSPQQQQPSIQLSLQQQLNPCKNVLLQQCSPVALVSSVRSKIFPQSECQVMQQQCCQQLAQIPQQLQCAAIHSVVHAIIMQQEQREGVQILLPQSHQQHVGQGALAQVQGIIQPQQLSQLEVVRSLVLQNLPTMCNVYVPRQCSTIQAPFASIETGIVGH
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide NVLLQQCSPVALVSSVR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Secale cereale | Rye | ADP95486 AFX60466 AFX60460 ADP95480 ADP95486 AFX60466 AFX60460 ADP95480 ADP95486 AFX60466 AFX60460 ADP95480 ADP95486 AFX60466 AFX60460 ADP95480 |
4550 |
| Secale strictum | Secale strictum | AEZ06409 AEZ06411 AEZ06409 AEZ06411 AEZ06409 AEZ06411 AEZ06409 AEZ06411 |
58866 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.