Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Rye gluten Protein: Rye gluten E5KZQ2 | 75k gamma secalin
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 407 amino acids
MKTLLMLAILAMATTIATANMQVNPSGQVQCPQQQPFPQPQKSSPQQPQQPFPQQSQQPFPQQPQQSSPQPLQPYPQQPFPQQPQQPYPQQPQQPFPQPPQQPFPQQPQQPVPQQSQQPFPQTQQPQQPFPQPQQPQQLFPQTQQSSPQQPQQVTSQPQQPFPQAQPPQQSSPQSQQPYPQEPQQLFPQSQQPQQPFPQPQQPQQPFPQPQPQTQQSIPQPQQPFPQPQQPFPQSQEQFPQVHQPQQPSPQQQQPSIQLSLQQQLNPCKNVLLQQCSPVALVSSLRSKIFPQSECQVMQQQCCQQLAQIPQQLQCAAIHSVVHAIIMQQEQREGVQILLPQSHQQHVGQGALAQVQGIIQPQQLSQLEVVRSLVLQNLPTMCNVYVPRQCSTIQAPFASIVTGIVGH
UniProt: E5KZQ2 IUIS: Rye gluten E5KZQ2Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| K | NVLLQQCSPVALVSSLR | S | 0 | 0.598 | 0.0 |
| R | SLVLQNLPTMCNVYVPR | Q | 0 | 0.533 | 0.0 |
| R | QCSTIQAPFASIVTGIVGH | $ | 0 | 0.667 | 0.0 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.