Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: LGDYLIDQGY
Peptide within the protein Gly-m-3:
MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERPGDYLIDQGY
MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERLGDYLIDQGY
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Soy | Gly-m-3.0102 | 3847 |
| Wheat | Tri-a-12.0101 | 4565 |
| Wheat | Tri-a-12.0102 | 4565 |
| Wheat | Tri-a-12.0103 | 4565 |
| Wheat | Tri-a-12.0104 | 4565 |
Species containing the peptide LGDYLIDQGY are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Glycine max | Soybean | NP_001236192 NP_001236192 NP_001236192 NP_001236192 NP_001236192 |
3847 |
| Hevea brasiliensis | Hevea brasiliensis | Q9STB6 Q9STB6 Q9STB6 Q9STB6 Q9STB6 |
3981 |
| Solanum tuberosum | Potato | XP_006353502 XP_006353502 XP_006353502 XP_006353502 XP_006353502 |
4113 |
| Triticum aestivum | Bread wheat | CAQ57979 P49234 P49233 P49232 CAQ57979 P49234 P49233 P49232 CAQ57979 P49234 P49233 P49232 CAQ57979 P49234 P49233 P49232 CAQ57979 P49234 P49233 P49232 |
4565 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.