If you found this site useful, please cite: Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Peptide: YMVIQGEPGAVIR

Peptide within the protein Gly-m-3:

Isoform: Gly-m-3.0101

MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERPGDYLIDQGY

Isoform: Gly-m-3.0102

MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERLGDYLIDQGY

References reporting this peptide:

None.


Species Uniqueness

Warning: nonspecific peptide

FoodProteinTaxid
HazelnutCor-a-2.0101 13451
HazelnutCor-a-2.0102 13451
SoyGly-m-3.0101 3847
SoyGly-m-3.0102 3847
RiceOry-s-12.0101 4530

Species containing the peptide YMVIQGEPGAVIR are presented below. Accessions and taxid values link to further information hosted on NCBI.

Species name Common name Accession(s) Tax ID
Brassica rapa subsp. pekinensis Chinese cabbage ABW17187
ABW17187
ABW17187
ABW17187
ABW17187
51351
Acer negundo Box elder AKU42160
AKU42160
AKU42160
AKU42160
AKU42160
4023
Aegilops tauschii Aegilops tauschii EMT03530
EMT00312
EMT25354
EMT03530
EMT00312
EMT25354
EMT03530
EMT00312
EMT25354
EMT03530
EMT00312
EMT25354
EMT03530
EMT00312
EMT25354
37682
Akebia trifoliata Akebia trifoliata ACV66156
ACV66156
ACV66156
ACV66156
ACV66156
155132
Amaranthus retroflexus Amaranthus retroflexus ACP43298
ACP43298
ACP43298
ACP43298
ACP43298
124763
Amaranthus viridis Amaranthus viridis ABW37745
ABW37744
ABW37745
ABW37744
ABW37745
ABW37744
ABW37745
ABW37744
ABW37745
ABW37744
56196
Amborella trichopoda Amborella trichopoda XP_006853720
XP_006853719
XP_006853720
XP_006853719
XP_006853720
XP_006853719
XP_006853720
XP_006853719
XP_006853720
XP_006853719
13333
Ambrosia artemisiifolia Common ragweed Q64LH2
Q64LH1
5EVE_A
AAX77687
AAX77688
5EV0_A
5EM1_A
Q64LH2
Q64LH1
5EVE_A
AAX77687
AAX77688
5EV0_A
5EM1_A
Q64LH2
Q64LH1
5EVE_A
AAX77687
AAX77688
5EV0_A
5EM1_A
Q64LH2
Q64LH1
5EVE_A
AAX77687
AAX77688
5EV0_A
5EM1_A
Q64LH2
Q64LH1
5EVE_A
AAX77687
AAX77688
5EV0_A
5EM1_A
4212
Ananas comosus Pineapple OAY82159
OAY82159
OAY82159
OAY82159
OAY82159
4615
Anthurium amnicola Anthurium amnicola JAT46484
JAT46484
JAT46484
JAT46484
JAT46484
1678845
Arabidopsis lyrata subsp. lyrata Arabidopsis lyrata subsp. lyrata XP_002869439
XP_002869439
XP_002869439
XP_002869439
XP_002869439
81972
Arabidopsis thaliana Thale cress AAO41991
NP_194663
AAO41991
NP_194663
AAO41991
NP_194663
AAO41991
NP_194663
AAO41991
NP_194663
3702
Arabis alpina Gray rockcress KFK29491
KFK29491
KFK29491
KFK29491
KFK29491
50452
Arachis duranensis Peanut ancestor XP_015966481
XP_015954188
XP_015966602
XP_015954280
XP_015966481
XP_015954188
XP_015966602
XP_015954280
XP_015966481
XP_015954188
XP_015966602
XP_015954280
XP_015966481
XP_015954188
XP_015966602
XP_015954280
XP_015966481
XP_015954188
XP_015966602
XP_015954280
130453
Arachis hypogaea Peanut ADB96066
ADB96066
ADB96066
ADB96066
ADB96066
3818
Brassica rapa subsp. rapa Turnip ABW17185
ABW17185
ABW17185
ABW17185
ABW17185
51350
Arachis ipaensis Arachis ipaensis XP_016203797
XP_016188756
XP_016203798
XP_016193360
XP_016203797
XP_016188756
XP_016203798
XP_016193360
XP_016203797
XP_016188756
XP_016203798
XP_016193360
XP_016203797
XP_016188756
XP_016203798
XP_016193360
XP_016203797
XP_016188756
XP_016203798
XP_016193360
130454
Beta vulgaris Beta vulgaris P85984
P85984
P85984
P85984
P85984
161934
Beta vulgaris subsp. vulgaris Sugar beet XP_010668781
XP_010668774
XP_010668781
XP_010668774
XP_010668781
XP_010668774
XP_010668781
XP_010668774
XP_010668781
XP_010668774
3555
Boea hygrometrica Boea hygrometrica KZV51397
KZV31832
KZV21627
KZV51397
KZV31832
KZV21627
KZV51397
KZV31832
KZV21627
KZV51397
KZV31832
KZV21627
KZV51397
KZV31832
KZV21627
472368
Brachypodium distachyon Brachypodium distachyon KQK03114
KQK03113
XP_003569765
XP_003564682
KQK03115
KQK03114
KQK03113
XP_003569765
XP_003564682
KQK03115
KQK03114
KQK03113
XP_003569765
XP_003564682
KQK03115
KQK03114
KQK03113
XP_003569765
XP_003564682
KQK03115
KQK03114
KQK03113
XP_003569765
XP_003564682
KQK03115
15368
Brassica juncea var. multiceps Brassica juncea var. multiceps ABW17183
ABW17183
ABW17183
ABW17183
ABW17183
323353
Brassica napus Rape XP_013744433
XP_013658912
CDY48726
XP_013732467
XP_009102139
XP_009117522
CDY35886
XP_009112626
XP_013732478
XP_013610150
XP_009128846
XP_013627199
XP_013667672
ABW17190
XP_009109044
XP_013744433
XP_013658912
CDY48726
XP_013732467
XP_009102139
XP_009117522
CDY35886
XP_009112626
XP_013732478
XP_013610150
XP_009128846
XP_013627199
XP_013667672
ABW17190
XP_009109044
XP_013744433
XP_013658912
CDY48726
XP_013732467
XP_009102139
XP_009117522
CDY35886
XP_009112626
XP_013732478
XP_013610150
XP_009128846
XP_013627199
XP_013667672
ABW17190
XP_009109044
XP_013744433
XP_013658912
CDY48726
XP_013732467
XP_009102139
XP_009117522
CDY35886
XP_009112626
XP_013732478
XP_013610150
XP_009128846
XP_013627199
XP_013667672
ABW17190
XP_009109044
XP_013744433
XP_013658912
CDY48726
XP_013732467
XP_009102139
XP_009117522
CDY35886
XP_009112626
XP_013732478
XP_013610150
XP_009128846
XP_013627199
XP_013667672
ABW17190
XP_009109044
3708
Brassica nigra Black mustard XP_009109044
XP_009109044
XP_009109044
XP_009109044
XP_009109044
3710
Brassica oleracea var. oleracea Brassica oleracea var. oleracea XP_009102139
XP_009112626
XP_013603388
XP_013596686
XP_013598048
XP_013610150
XP_013627199
XP_013599981
XP_009102139
XP_009112626
XP_013603388
XP_013596686
XP_013598048
XP_013610150
XP_013627199
XP_013599981
XP_009102139
XP_009112626
XP_013603388
XP_013596686
XP_013598048
XP_013610150
XP_013627199
XP_013599981
XP_009102139
XP_009112626
XP_013603388
XP_013596686
XP_013598048
XP_013610150
XP_013627199
XP_013599981
XP_009102139
XP_009112626
XP_013603388
XP_013596686
XP_013598048
XP_013610150
XP_013627199
XP_013599981
109376
Brassica rapa Field mustard XP_009102139
XP_009117522
XP_009112626
ABP35953
XP_009117521
XP_009112628
XP_009137845
XP_009128846
XP_009109044
XP_009102139
XP_009117522
XP_009112626
ABP35953
XP_009117521
XP_009112628
XP_009137845
XP_009128846
XP_009109044
XP_009102139
XP_009117522
XP_009112626
ABP35953
XP_009117521
XP_009112628
XP_009137845
XP_009128846
XP_009109044
XP_009102139
XP_009117522
XP_009112626
ABP35953
XP_009117521
XP_009112628
XP_009137845
XP_009128846
XP_009109044
XP_009102139
XP_009117522
XP_009112626
ABP35953
XP_009117521
XP_009112628
XP_009137845
XP_009128846
XP_009109044
3711
Musa acuminata subsp. malaccensis Wild malaysian banana XP_009421433
XP_009415731
XP_009409369
XP_009405712
XP_009404548
XP_009400573
XP_009392682
XP_009389903
XP_009405220
XP_009389902
XP_009389901
XP_009389900
XP_009421433
XP_009415731
XP_009409369
XP_009405712
XP_009404548
XP_009400573
XP_009392682
XP_009389903
XP_009405220
XP_009389902
XP_009389901
XP_009389900
XP_009421433
XP_009415731
XP_009409369
XP_009405712
XP_009404548
XP_009400573
XP_009392682
XP_009389903
XP_009405220
XP_009389902
XP_009389901
XP_009389900
XP_009421433
XP_009415731
XP_009409369
XP_009405712
XP_009404548
XP_009400573
XP_009392682
XP_009389903
XP_009405220
XP_009389902
XP_009389901
XP_009389900
XP_009421433
XP_009415731
XP_009409369
XP_009405712
XP_009404548
XP_009400573
XP_009392682
XP_009389903
XP_009405220
XP_009389902
XP_009389901
XP_009389900
214687
Brassica rapa var. purpuraria Brassica rapa var. purpuraria XP_009109044
XP_009109044
XP_009109044
XP_009109044
XP_009109044
386281
Cajanus cajan Pigeon pea KYP67492
KYP67491
KYP67493
KYP61390
KYP67492
KYP67491
KYP67493
KYP61390
KYP67492
KYP67491
KYP67493
KYP61390
KYP67492
KYP67491
KYP67493
KYP61390
KYP67492
KYP67491
KYP67493
KYP61390
3821
Camellia sinensis Camellia sinensis AEC10960
AEC10960
AEC10960
AEC10960
AEC10960
4442
Capsella rubella Capsella rubella XP_006298806
XP_006298806
XP_006298806
XP_006298806
XP_006298806
81985
Capsicum annuum Capsicum annuum XP_016578592
XP_016578592
XP_016578592
XP_016578592
XP_016578592
4072
Caryota mitis Burmese fishtail palm ABM53030
ABM53030
ABM53030
ABM53030
ABM53030
4714
Cenchrus americanus Cenchrus americanus AGN33441
AGN33441
AGN33441
AGN33441
AGN33441
4543
Chenopodium album Chenopodium album ACR77509
ACR77509
ACR77509
ACR77509
ACR77509
3559
Cicer arietinum Chickpea XP_004503498
XP_004513067
XP_004503499
XP_004503498
XP_004513067
XP_004503499
XP_004503498
XP_004513067
XP_004503499
XP_004503498
XP_004513067
XP_004503499
XP_004503498
XP_004513067
XP_004503499
3827
Cinnamomum camphora Camphor tree ABC61055
ABC61055
ABC61055
ABC61055
ABC61055
13429
Citrullus lanatus Citrullus lanatus AAU43733
AAU43733
AAU43733
AAU43733
AAU43733
3654
Citrus clementina Citrus clementina XP_006426856
XP_006451338
XP_006426857
XP_006426856
XP_006451338
XP_006426857
XP_006426856
XP_006451338
XP_006426857
XP_006426856
XP_006451338
XP_006426857
XP_006426856
XP_006451338
XP_006426857
85681
Citrus sinensis Sweet orange KDO51830
XP_006426856
KDO55854
XP_006451338
XP_006426857
KDO51830
XP_006426856
KDO55854
XP_006451338
XP_006426857
KDO51830
XP_006426856
KDO55854
XP_006451338
XP_006426857
KDO51830
XP_006426856
KDO55854
XP_006451338
XP_006426857
KDO51830
XP_006426856
KDO55854
XP_006451338
XP_006426857
2711
Cleome hassleriana Cleome hassleriana XP_010526418
XP_010541007
XP_010536838
XP_010536839
XP_010526419
XP_010541006
XP_010526418
XP_010541007
XP_010536838
XP_010536839
XP_010526419
XP_010541006
XP_010526418
XP_010541007
XP_010536838
XP_010536839
XP_010526419
XP_010541006
XP_010526418
XP_010541007
XP_010536838
XP_010536839
XP_010526419
XP_010541006
XP_010526418
XP_010541007
XP_010536838
XP_010536839
XP_010526419
XP_010541006
28532
Cocos nucifera Coconut palm ABM53028
ABM53028
ABM53028
ABM53028
ABM53028
13894
Coffea canephora Coffea canephora CDP03236
CDP03236
CDP03236
CDP03236
CDP03236
49390
Corylus avellana Corylus avellana AAK01235
AAK01236
AAK01235
AAK01236
AAK01235
AAK01236
AAK01235
AAK01236
AAK01235
AAK01236
13451
Cucumis melo Muskmelon NP_001284474
XP_008458990
XP_008458981
NP_001284474
XP_008458990
XP_008458981
NP_001284474
XP_008458990
XP_008458981
NP_001284474
XP_008458990
XP_008458981
NP_001284474
XP_008458990
XP_008458981
3656
Cucumis melo var. cantalupensis Cucumis melo var. cantalupensis AAP42151
XP_008458990
AAP42151
XP_008458990
AAP42151
XP_008458990
AAP42151
XP_008458990
AAP42151
XP_008458990
3658
Oryza sativa Japonica Group Japanese rice XP_015613779
XP_015613779
XP_015613779
XP_015613779
XP_015613779
39947
Cucumis sativus Cucumber ABK55708
XP_004141028
XP_004141027
ABK55708
XP_004141028
XP_004141027
ABK55708
XP_004141028
XP_004141027
ABK55708
XP_004141028
XP_004141027
ABK55708
XP_004141028
XP_004141027
3659
Cynara cardunculus var. scolymus Cynara cardunculus var. scolymus KVI01195
KVI01195
KVI01195
KVI01195
KVI01195
59895
Cynodon dactylon Bermuda grass O04725
O04725
O04725
O04725
O04725
28909
Elaeis guineensis African oil palm XP_010924449
XP_010914952
XP_010924448
AAQ63001
AAQ63002
AAQ63003
XP_010924449
XP_010914952
XP_010924448
AAQ63001
AAQ63002
AAQ63003
XP_010924449
XP_010914952
XP_010924448
AAQ63001
AAQ63002
AAQ63003
XP_010924449
XP_010914952
XP_010924448
AAQ63001
AAQ63002
AAQ63003
XP_010924449
XP_010914952
XP_010924448
AAQ63001
AAQ63002
AAQ63003
51953
Eucalyptus grandis Eucalyptus grandis KCW79608
XP_010047663
KCW79608
XP_010047663
KCW79608
XP_010047663
KCW79608
XP_010047663
KCW79608
XP_010047663
71139
Fragaria vesca subsp. vesca Fragaria vesca subsp. vesca XP_004287490
XP_004287490
XP_004287490
XP_004287490
XP_004287490
101020
Fragaria x ananassa Strawberry P0C0Y3
P0C0Y3
P0C0Y3
P0C0Y3
P0C0Y3
3747
Genlisea aurea Genlisea aurea EPS71087
EPS59245
EPS71087
EPS59245
EPS71087
EPS59245
EPS71087
EPS59245
EPS71087
EPS59245
192259
Glycine max Soybean KRH41479
NP_001237519
KRH60196
O65809
NP_001236192
KHM99817
XP_003546590
NP_001235025
XP_006583560
XP_003516387
KRH41479
NP_001237519
KRH60196
O65809
NP_001236192
KHM99817
XP_003546590
NP_001235025
XP_006583560
XP_003516387
KRH41479
NP_001237519
KRH60196
O65809
NP_001236192
KHM99817
XP_003546590
NP_001235025
XP_006583560
XP_003516387
KRH41479
NP_001237519
KRH60196
O65809
NP_001236192
KHM99817
XP_003546590
NP_001235025
XP_006583560
XP_003516387
KRH41479
NP_001237519
KRH60196
O65809
NP_001236192
KHM99817
XP_003546590
NP_001235025
XP_006583560
XP_003516387
3847
Glycine soja Glycine soja KHM98711
NP_001237519
KHN16653
KHM99817
XP_006583560
XP_003516387
KHM98711
NP_001237519
KHN16653
KHM99817
XP_006583560
XP_003516387
KHM98711
NP_001237519
KHN16653
KHM99817
XP_006583560
XP_003516387
KHM98711
NP_001237519
KHN16653
KHM99817
XP_006583560
XP_003516387
KHM98711
NP_001237519
KHN16653
KHM99817
XP_006583560
XP_003516387
3848
Gossypium arboreum Gossypium arboreum AEI52726
AEI52762
AEI52738
AEI52769
XP_016754678
XP_017645931
XP_016729138
XP_012449008
XP_017642620
AEI52726
AEI52762
AEI52738
AEI52769
XP_016754678
XP_017645931
XP_016729138
XP_012449008
XP_017642620
AEI52726
AEI52762
AEI52738
AEI52769
XP_016754678
XP_017645931
XP_016729138
XP_012449008
XP_017642620
AEI52726
AEI52762
AEI52738
AEI52769
XP_016754678
XP_017645931
XP_016729138
XP_012449008
XP_017642620
AEI52726
AEI52762
AEI52738
AEI52769
XP_016754678
XP_017645931
XP_016729138
XP_012449008
XP_017642620
29729
Gossypium barbadense Sea-island cotton AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
3634
Gossypium darwinii Gossypium darwinii AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
34276
Gossypium herbaceum Gossypium herbaceum AEI52727
AEI52762
AEI52738
AEI52769
AEI52727
AEI52762
AEI52738
AEI52769
AEI52727
AEI52762
AEI52738
AEI52769
AEI52727
AEI52762
AEI52738
AEI52769
AEI52727
AEI52762
AEI52738
AEI52769
34274
Gossypium herbaceum subsp. africanum Gossypium herbaceum subsp. africanum AEI52727
AEI52762
AEI52738
AEI52769
AEI52727
AEI52762
AEI52738
AEI52769
AEI52727
AEI52762
AEI52738
AEI52769
AEI52727
AEI52762
AEI52738
AEI52769
AEI52727
AEI52762
AEI52738
AEI52769
76056
Gossypium hirsutum Upland cotton AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
XP_016682541
XP_016754678
XP_016750049
XP_012442617
XP_016729138
XP_016720500
XP_012449008
XP_016729122
XP_016755336
AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
XP_016682541
XP_016754678
XP_016750049
XP_012442617
XP_016729138
XP_016720500
XP_012449008
XP_016729122
XP_016755336
AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
XP_016682541
XP_016754678
XP_016750049
XP_012442617
XP_016729138
XP_016720500
XP_012449008
XP_016729122
XP_016755336
AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
XP_016682541
XP_016754678
XP_016750049
XP_012442617
XP_016729138
XP_016720500
XP_012449008
XP_016729122
XP_016755336
AEI52726
AEI52721
AEI52762
AEI52757
AEI52738
AEI52734
AEI52770
AEI52769
XP_016682541
XP_016754678
XP_016750049
XP_012442617
XP_016729138
XP_016720500
XP_012449008
XP_016729122
XP_016755336
3635
Gossypium raimondii Gossypium raimondii AEI52721
KJB63403
AEI52757
AEI52769
KJB63405
XP_012450327
XP_012442617
XP_012449008
XP_012434569
AEI52721
KJB63403
AEI52757
AEI52769
KJB63405
XP_012450327
XP_012442617
XP_012449008
XP_012434569
AEI52721
KJB63403
AEI52757
AEI52769
KJB63405
XP_012450327
XP_012442617
XP_012449008
XP_012434569
AEI52721
KJB63403
AEI52757
AEI52769
KJB63405
XP_012450327
XP_012442617
XP_012449008
XP_012434569
AEI52721
KJB63403
AEI52757
AEI52769
KJB63405
XP_012450327
XP_012442617
XP_012449008
XP_012434569
29730
Hevea brasiliensis Hevea brasiliensis Q9STB6
Q9M7M8
Q9LEI8
1G5U_A
Q9M7N0
Q9M7M9
Q9STB6
Q9M7M8
Q9LEI8
1G5U_A
Q9M7N0
Q9M7M9
Q9STB6
Q9M7M8
Q9LEI8
1G5U_A
Q9M7N0
Q9M7M9
Q9STB6
Q9M7M8
Q9LEI8
1G5U_A
Q9M7N0
Q9M7M9
Q9STB6
Q9M7M8
Q9LEI8
1G5U_A
Q9M7N0
Q9M7M9
3981
Hordeum vulgare subsp. vulgare Domesticated barley BAK07752
BAK06398
BAJ86041
BAK07752
BAK06398
BAJ86041
BAK07752
BAK06398
BAJ86041
BAK07752
BAK06398
BAJ86041
BAK07752
BAK06398
BAJ86041
112509
Humulus scandens Humulus scandens AAP15200
AAP15200
AAP15200
AAP15200
AAP15200
228586
Jatropha curcas Jatropha curcas NP_001295719
NP_001295658
NP_001295719
NP_001295658
NP_001295719
NP_001295658
NP_001295719
NP_001295658
NP_001295719
NP_001295658
180498
Lilium longiflorum Trumpet lily Q9SNW5
Q9SNW7
Q9SNW6
Q9SNW5
Q9SNW7
Q9SNW6
Q9SNW5
Q9SNW7
Q9SNW6
Q9SNW5
Q9SNW7
Q9SNW6
Q9SNW5
Q9SNW7
Q9SNW6
4690
Litchi chinensis Litchi chinensis ABC02750
Q941H7
ABC02750
Q941H7
ABC02750
Q941H7
ABC02750
Q941H7
ABC02750
Q941H7
151069
Lotus japonicus Lotus japonicus AFK47285
AFK47224
AFK38257
AFK47381
AFK47285
AFK47224
AFK38257
AFK47381
AFK47285
AFK47224
AFK38257
AFK47381
AFK47285
AFK47224
AFK38257
AFK47381
AFK47285
AFK47224
AFK38257
AFK47381
34305
Malus domestica Apple CAT99619
Q9XF42
CAK93757
CAK93753
CAD46561
XP_008337608
CAT99619
Q9XF42
CAK93757
CAK93753
CAD46561
XP_008337608
CAT99619
Q9XF42
CAK93757
CAK93753
CAD46561
XP_008337608
CAT99619
Q9XF42
CAK93757
CAK93753
CAD46561
XP_008337608
CAT99619
Q9XF42
CAK93757
CAK93753
CAD46561
XP_008337608
3750
Mangifera indica Mango ABD62998
ABB76134
ABD62998
ABB76134
ABD62998
ABB76134
ABD62998
ABB76134
ABD62998
ABB76134
29780
Manihot esculenta Cassava OAY26766
OAY53847
OAY53092
OAY27196
OAY26767
OAY26766
OAY53847
OAY53092
OAY27196
OAY26767
OAY26766
OAY53847
OAY53092
OAY27196
OAY26767
OAY26766
OAY53847
OAY53092
OAY27196
OAY26767
OAY26766
OAY53847
OAY53092
OAY27196
OAY26767
3983
Medicago truncatula Barrel medic ACJ83967
AFK47485
AFK40156
XP_003620753
XP_003630698
ACJ83967
AFK47485
AFK40156
XP_003620753
XP_003630698
ACJ83967
AFK47485
AFK40156
XP_003620753
XP_003630698
ACJ83967
AFK47485
AFK40156
XP_003620753
XP_003630698
ACJ83967
AFK47485
AFK40156
XP_003620753
XP_003630698
3880
Mimulus guttatus Spotted monkey flower EYU30693
EYU30691
XP_012845417
XP_012845482
XP_012856302
XP_012857964
EYU30693
EYU30691
XP_012845417
XP_012845482
XP_012856302
XP_012857964
EYU30693
EYU30691
XP_012845417
XP_012845482
XP_012856302
XP_012857964
EYU30693
EYU30691
XP_012845417
XP_012845482
XP_012856302
XP_012857964
EYU30693
EYU30691
XP_012845417
XP_012845482
XP_012856302
XP_012857964
4155
Morus notabilis Morus notabilis XP_010098156
XP_010095450
XP_010098156
XP_010095450
XP_010098156
XP_010095450
XP_010098156
XP_010095450
XP_010098156
XP_010095450
981085
Musa acuminata Dwarf banana Q94JN3
Q94JN3
Q94JN3
Q94JN3
Q94JN3
4641
Nelumbo nucifera Nelumbo nucifera XP_010267106
XP_010249472
XP_010267106
XP_010249472
XP_010267106
XP_010249472
XP_010267106
XP_010249472
XP_010267106
XP_010249472
4432
Nicotiana benthamiana Nicotiana benthamiana ABF60824
ABF60824
ABF60824
ABF60824
ABF60824
4100
Nicotiana sylvestris Wood tobacco XP_009796122
XP_009777310
XP_009789538
XP_009796122
XP_009777310
XP_009789538
XP_009796122
XP_009777310
XP_009789538
XP_009796122
XP_009777310
XP_009789538
XP_009796122
XP_009777310
XP_009789538
4096
Nicotiana tabacum Common tobacco XP_009796122
XP_009602785
XP_016465009
XP_009777310
Q9ST98
XP_009789538
XP_009591293
P41372
Q9ST99
CAB61833
XP_009796122
XP_009602785
XP_016465009
XP_009777310
Q9ST98
XP_009789538
XP_009591293
P41372
Q9ST99
CAB61833
XP_009796122
XP_009602785
XP_016465009
XP_009777310
Q9ST98
XP_009789538
XP_009591293
P41372
Q9ST99
CAB61833
XP_009796122
XP_009602785
XP_016465009
XP_009777310
Q9ST98
XP_009789538
XP_009591293
P41372
Q9ST99
CAB61833
XP_009796122
XP_009602785
XP_016465009
XP_009777310
Q9ST98
XP_009789538
XP_009591293
P41372
Q9ST99
CAB61833
4097
Nicotiana tomentosiformis Nicotiana tomentosiformis XP_009602785
XP_009622655
XP_009591293
XP_009602785
XP_009622655
XP_009591293
XP_009602785
XP_009622655
XP_009591293
XP_009602785
XP_009622655
XP_009591293
XP_009602785
XP_009622655
XP_009591293
4098
Olea europaea Common olive A4KA61
A4KA49
A4KA52
A4KA53
A4KA50
A4GFC2
A4GFC3
A4GFC0
A4GFC4
ABU97473
A4GFB7
A4KA61
A4KA49
A4KA52
A4KA53
A4KA50
A4GFC2
A4GFC3
A4GFC0
A4GFC4
ABU97473
A4GFB7
A4KA61
A4KA49
A4KA52
A4KA53
A4KA50
A4GFC2
A4GFC3
A4GFC0
A4GFC4
ABU97473
A4GFB7
A4KA61
A4KA49
A4KA52
A4KA53
A4KA50
A4GFC2
A4GFC3
A4GFC0
A4GFC4
ABU97473
A4GFB7
A4KA61
A4KA49
A4KA52
A4KA53
A4KA50
A4GFC2
A4GFC3
A4GFC0
A4GFC4
ABU97473
A4GFB7
4146
Oryza brachyantha Malo sina XP_006661691
XP_006661690
XP_006661691
XP_006661690
XP_006661691
XP_006661690
XP_006661691
XP_006661690
XP_006661691
XP_006661690
4533
Oryza sativa Rice XP_015613779
XP_015613779
XP_015613779
XP_015613779
XP_015613779
4530
Oryza sativa Indica Group Long-grained rice XP_015613779
XP_015613779
XP_015613779
XP_015613779
XP_015613779
39946
Petunia x hybrida Petunia x hybrida AAD02560
AAD02560
AAD02560
AAD02560
AAD02560
4102
Phalaenopsis hybrid cultivar Phalaenopsis hybrid cultivar AAD21619
AAD21619
AAD21619
AAD21619
AAD21619
200642
Phaseolus vulgaris Phaseolus vulgaris XP_007150593
XP_007160276
XP_007152957
XP_007150593
XP_007160276
XP_007152957
XP_007150593
XP_007160276
XP_007152957
XP_007150593
XP_007160276
XP_007152957
XP_007150593
XP_007160276
XP_007152957
3885
Phleum pratense Timothy grass A4KA33
A4KA32
A4KA38
A4KA36
A4KA49
A4KA34
O24282
O24650
A4KA33
A4KA32
A4KA38
A4KA36
A4KA49
A4KA34
O24282
O24650
A4KA33
A4KA32
A4KA38
A4KA36
A4KA49
A4KA34
O24282
O24650
A4KA33
A4KA32
A4KA38
A4KA36
A4KA49
A4KA34
O24282
O24650
A4KA33
A4KA32
A4KA38
A4KA36
A4KA49
A4KA34
O24282
O24650
15957
Phoenix dactylifera Date palm NP_001288607
XP_008799779
XP_008799778
XP_008795503
XP_008795502
NP_001288607
XP_008799779
XP_008799778
XP_008795503
XP_008795502
NP_001288607
XP_008799779
XP_008799778
XP_008795503
XP_008795502
NP_001288607
XP_008799779
XP_008799778
XP_008795503
XP_008795502
NP_001288607
XP_008799779
XP_008799778
XP_008795503
XP_008795502
42345
Picea sitchensis Sitka spruce ABK27012
ABK22288
ABK27012
ABK22288
ABK27012
ABK22288
ABK27012
ABK22288
ABK27012
ABK22288
3332
Pinus lambertiana Sugar pine AEW08237
AEW08237
AEW08237
AEW08237
AEW08237
3343
Pinus sylvestris Scots pine ACJ70453
ACJ70450
ACJ70452
ACJ70448
ACJ70454
ACJ70446
ACJ70453
ACJ70450
ACJ70452
ACJ70448
ACJ70454
ACJ70446
ACJ70453
ACJ70450
ACJ70452
ACJ70448
ACJ70454
ACJ70446
ACJ70453
ACJ70450
ACJ70452
ACJ70448
ACJ70454
ACJ70446
ACJ70453
ACJ70450
ACJ70452
ACJ70448
ACJ70454
ACJ70446
3349
Populus euphratica Populus euphratica XP_011005518
XP_011000942
XP_002304225
XP_011005518
XP_011000942
XP_002304225
XP_011005518
XP_011000942
XP_002304225
XP_011005518
XP_011000942
XP_002304225
XP_011005518
XP_011000942
XP_002304225
75702
Raphanus sativus Radish ABW17183
ABW17183
ABW17183
ABW17183
ABW17183
3726
Populus trichocarpa Black cottonwood XP_002299743
XP_002324161
XP_002304225
XP_002299743
XP_002324161
XP_002304225
XP_002299743
XP_002324161
XP_002304225
XP_002299743
XP_002324161
XP_002304225
XP_002299743
XP_002324161
XP_002304225
3694
Prunus dulcis x Prunus persica Prunus dulcis x prunus persica XP_007202751
XP_007202751
XP_007202751
XP_007202751
XP_007202751
472390
Prunus mume Japanese apricot XP_007202751
XP_008242467
XP_007202751
XP_008242467
XP_007202751
XP_008242467
XP_007202751
XP_008242467
XP_007202751
XP_008242467
102107
Prunus persica Peach Q8GT39
XP_007202751
XP_007204758
XP_007204757
Q8GT39
XP_007202751
XP_007204758
XP_007204757
Q8GT39
XP_007202751
XP_007204758
XP_007204757
Q8GT39
XP_007202751
XP_007204758
XP_007204757
Q8GT39
XP_007202751
XP_007204758
XP_007204757
3760
Pyrus x bretschneideri Pyrus x bretschneideri XP_009367418
XP_009352573
XP_009367418
XP_009352573
XP_009367418
XP_009352573
XP_009367418
XP_009352573
XP_009367418
XP_009352573
225117
Quercus suber Quercus suber AFG16926
AFG16925
AFG16923
AFG16922
AFG16926
AFG16925
AFG16923
AFG16922
AFG16926
AFG16925
AFG16923
AFG16922
AFG16926
AFG16925
AFG16923
AFG16922
AFG16926
AFG16925
AFG16923
AFG16922
58331
Ricinus communis Castor bean XP_002514199
XP_002515952
XP_002514198
XP_002514199
XP_002515952
XP_002514198
XP_002514199
XP_002515952
XP_002514198
XP_002514199
XP_002515952
XP_002514198
XP_002514199
XP_002515952
XP_002514198
3988
Roystonea regia Roystonea regia ABM53029
ABM53029
ABM53029
ABM53029
ABM53029
145709
Salsola kali Salsola kali ADK22841
ADK22841
ADK22841
ADK22841
ADK22841
151250
Secale cereale x Triticum durum Secale cereale x triticum durum AEW90957
AEW90957
AEW90957
AEW90957
AEW90957
142809
Sesamum indicum Sesame XP_011081736
XP_011078238
XP_011072445
XP_011078237
XP_011081736
XP_011078238
XP_011072445
XP_011078237
XP_011081736
XP_011078238
XP_011072445
XP_011078237
XP_011081736
XP_011078238
XP_011072445
XP_011078237
XP_011081736
XP_011078238
XP_011072445
XP_011078237
4182
Setaria italica Foxtail millet XP_004969894
XP_004964829
XP_004961445
XP_004968458
KQL06902
XP_004969894
XP_004964829
XP_004961445
XP_004968458
KQL06902
XP_004969894
XP_004964829
XP_004961445
XP_004968458
KQL06902
XP_004969894
XP_004964829
XP_004961445
XP_004968458
KQL06902
XP_004969894
XP_004964829
XP_004961445
XP_004968458
KQL06902
4555
Solanum lycopersicum Tomato XP_004241753
NP_001233869
XP_004241753
NP_001233869
XP_004241753
NP_001233869
XP_004241753
NP_001233869
XP_004241753
NP_001233869
4081
Solanum pennellii Solanum pennellii XP_015077960
NP_001233869
XP_015077960
NP_001233869
XP_015077960
NP_001233869
XP_015077960
NP_001233869
XP_015077960
NP_001233869
28526
Solanum tuberosum Potato NP_001275370
ABA81885
XP_006356135
NP_001275370
ABA81885
XP_006356135
NP_001275370
ABA81885
XP_006356135
NP_001275370
ABA81885
XP_006356135
NP_001275370
ABA81885
XP_006356135
4113
Sonneratia alba Sonneratia alba ABQ41917
ABQ41913
ACS68650
ABQ41917
ABQ41913
ACS68650
ABQ41917
ABQ41913
ACS68650
ABQ41917
ABQ41913
ACS68650
ABQ41917
ABQ41913
ACS68650
122812
Sonneratia apetala Sonneratia apetala ABQ41913
ABQ41913
ABQ41913
ABQ41913
ABQ41913
122813
Sonneratia caseolaris Sonneratia caseolaris ABQ41918
ABQ41913
ABQ41918
ABQ41913
ABQ41918
ABQ41913
ABQ41918
ABQ41913
ABQ41918
ABQ41913
122814
Sonneratia ovata Sonneratia ovata ABQ41918
ABQ41913
ABQ41918
ABQ41913
ABQ41918
ABQ41913
ABQ41918
ABQ41913
ABQ41918
ABQ41913
122816
Sorghum bicolor Sorghum XP_002441408
XP_002456332
XP_002436493
XP_002441408
XP_002456332
XP_002436493
XP_002441408
XP_002456332
XP_002436493
XP_002441408
XP_002456332
XP_002436493
XP_002441408
XP_002456332
XP_002436493
4558
Spinacia oleracea Spinach KNA07985
KNA04623
KNA04146
KNA07985
KNA04623
KNA04146
KNA07985
KNA04623
KNA04146
KNA07985
KNA04623
KNA04146
KNA07985
KNA04623
KNA04146
3562
Theobroma cacao Cacao XP_007012987
XP_007024334
XP_007012985
XP_007012196
XP_017983788
EOY29816
XP_007012987
XP_007024334
XP_007012985
XP_007012196
XP_017983788
EOY29816
XP_007012987
XP_007024334
XP_007012985
XP_007012196
XP_017983788
EOY29816
XP_007012987
XP_007024334
XP_007012985
XP_007012196
XP_017983788
EOY29816
XP_007012987
XP_007024334
XP_007012985
XP_007012196
XP_017983788
EOY29816
3641
Trifolium subterraneum Trifolium subterraneum GAU11744
GAU11745
GAU11744
GAU11745
GAU11744
GAU11745
GAU11744
GAU11745
GAU11744
GAU11745
3900
Triticum aestivum Bread wheat CDM81724
CDM84005
CDM81724
CDM84005
CDM81724
CDM84005
CDM81724
CDM84005
CDM81724
CDM84005
4565
Triticum urartu Triticum urartu EMS49855
EMS66850
EMS49855
EMS66850
EMS49855
EMS66850
EMS49855
EMS66850
EMS49855
EMS66850
4572
Vigna angularis Adzuki bean XP_017441865
XP_017439380
XP_017441865
XP_017439380
XP_017441865
XP_017439380
XP_017441865
XP_017439380
XP_017441865
XP_017439380
3914
Vigna angularis var. angularis Vigna angularis var. angularis XP_017441865
XP_017439380
XP_017441865
XP_017439380
XP_017441865
XP_017439380
XP_017441865
XP_017439380
XP_017441865
XP_017439380
157739
Vigna radiata var. radiata Mung bean XP_014508095
XP_014508684
XP_014508095
XP_014508684
XP_014508095
XP_014508684
XP_014508095
XP_014508684
XP_014508095
XP_014508684
3916
Vitis vinifera Wine grape XP_002283490
CAN67015
XP_010656249
XP_002274966
XP_002283490
CAN67015
XP_010656249
XP_002274966
XP_002283490
CAN67015
XP_010656249
XP_002274966
XP_002283490
CAN67015
XP_010656249
XP_002274966
XP_002283490
CAN67015
XP_010656249
XP_002274966
29760
Zea mays Zea mays A4KA61
ABQ23999
NP_001105987
A4KA60
A4KA55
A4KA57
A4KA59
NP_001106002
P35082
NP_001105450
ACN36779
NP_001288512
NP_001105452
AFW85125
NP_001149484
DAA57720
NP_001105451
AFW85126
A4KA61
ABQ23999
NP_001105987
A4KA60
A4KA55
A4KA57
A4KA59
NP_001106002
P35082
NP_001105450
ACN36779
NP_001288512
NP_001105452
AFW85125
NP_001149484
DAA57720
NP_001105451
AFW85126
A4KA61
ABQ23999
NP_001105987
A4KA60
A4KA55
A4KA57
A4KA59
NP_001106002
P35082
NP_001105450
ACN36779
NP_001288512
NP_001105452
AFW85125
NP_001149484
DAA57720
NP_001105451
AFW85126
A4KA61
ABQ23999
NP_001105987
A4KA60
A4KA55
A4KA57
A4KA59
NP_001106002
P35082
NP_001105450
ACN36779
NP_001288512
NP_001105452
AFW85125
NP_001149484
DAA57720
NP_001105451
AFW85126
A4KA61
ABQ23999
NP_001105987
A4KA60
A4KA55
A4KA57
A4KA59
NP_001106002
P35082
NP_001105450
ACN36779
NP_001288512
NP_001105452
AFW85125
NP_001149484
DAA57720
NP_001105451
AFW85126
4577
Ziziphus jujuba Ziziphus jujuba XP_015902066
XP_015899512
XP_015885522
XP_015902066
XP_015899512
XP_015885522
XP_015902066
XP_015899512
XP_015885522
XP_015902066
XP_015899512
XP_015885522
XP_015902066
XP_015899512
XP_015885522
326968

BLAST non-redundant protein database version: 4, date: December 9, 2015.

See the About page for more information.