If you found this site useful, please cite: Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Soy Protein: Gly m 5 | β-Conglycinin (Vicilin, 7S Globulin)

Isoform:

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 543 amino acids

VEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERKQEEDEDEEQQRESEESEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY

UniProt: O22120   IUIS: Gly m 5

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 559 amino acids

VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY

UniProt: Q9FZP9   IUIS: Gly m 5

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 439 amino acids

MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYLRSSNSFQTLFENQNGRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLLGEEEEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY

UniProt: P25974-1   IUIS: Gly m 5

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 439 amino acids

MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQNGRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY

UniProt: P25974-2   IUIS: Gly m 5

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:
Peptide Characteristics:

Minimum length:

Maximum length:

1Peptide2Exp.3ESP4CONSeQ5
K GPFPSILGALY $ 0 0.427 0.40336
K GPLSSILR A 0 0.336 0.62248
R DLDIFLSIVDMNEGALLLPHFNSK A 4 0.586 0.02084
R DLDVFLSVVDMNEGALFLPHFNSK A 2 0.582 0.02366
R DLDIFLSSVDINEGALLLPHFNSK A 2 0.713 0.02604
R IVQFQSKPNTILLPHHADADFLLFVLSGR A 1 0.173 0.04858
K DNVISQIPSQVQELAFPGSAK D 2 0.842 0.23926
R NFLAGSK D 2 0.234 0.13864
R NFLAGEK D 1 0.243 0.15904
R SQQLQNLR D 3 0.273 0.3846
R SPQLQNLR D 3 0.307 0.53638
R SPQLENLR D 2 0.321 0.58208
R AILTLVNNDDR D 2 0.735 0.78706
K AIVILVINEGDANIELVGLK E 3 0.483 0.11316
K AIVILVINEGDANIELVGIK E 2 0.47 0.12148
K GSEEEQDER E 2 0.209 0.1296
K AIVVLVINEGEANIELVGIK E 3 0.439 0.13348
K ESQESEGSESQR E 1 0.28 0.15806
K QEEDEDEEQQR E 2 0.312 0.26724
K ESEEEEEDQDEDEEQDK E 2 0.451 0.28198
K EECEEGEIPRPRPRPQHPER E 0 0.365 0.32986
K SQSESYFVDAQPQQK E 2 0.597 0.45888
R EPQQPGEK E 1 0.206 0.14966
R QEEEHEQR E 1 0.211 0.19714
R EHPRPHQPHQK E 1 0.154 0.23408
R QPHQEEEHEQK E 0 0.266 0.23436
R QFPFPRPPHQK E 3 0.204 0.40308
R LQESVIVEISK E 4 0.496 0.52658
R ESYFVDAQPQQK E 1 0.522 0.53044
R QQEGVIVELSK E 2 0.462 0.68176
^ VEEEEECEEGQIPRPRPQHPER E 0 0.494 0.36234
K NPFLFGSNR F 3 0.586 0.51772
K NILEASYDTK F 3 0.476 0.77914
R NPIYSNNFGK F 2 0.503 0.4255
R LITLAIPVNKPGR F 7 0.38 0.63246
R MITLAIPVNKPGR F 4 0.347 0.6558
R NILEASYDTK F 3 0.476 0.77914
R IPAGTTYYLVNPHDHQNLK I 1 0.668 0.1727
R DSYNLHPGDAQR I 2 0.618 0.2405
R SSNSFQTLFENQNGR I 1 0.684 0.44082
K EEHEWHR K 0 0.175 0.11114
K EQQQEQQQEEQPLEVR K 4 0.517 0.39196
R EEQEWPR K 1 0.251 0.16734
R QQQEEQPLEVR K 5 0.391 0.3806
R LQESVIVEISK K 4 0.496 0.52658
R ESYFVDAQPK K 5 0.507 0.71274
R DPIYSNK L 2 0.211 0.2019
R EEGQQQGEER L 3 0.249 0.20224
R EEGQQQGEQR L 3 0.265 0.22268
R VPSGTTYYVVNPDNNENLR L 5 0.722 0.27154
R QVQELAFPGSAQDVER L 3 0.825 0.80748
R VPAGTTYYVVNPDNDENLR M 2 0.766 0.2374
K FFEITPEK N 3 0.325 0.4369
K LFEITPEK N 1 0.307 0.69788
R FESFFLSSTEAQQSYLQGFSR N 3 0.39 0.08044
R FESFFLSSTQAQQSYLQGFSK N 2 0.395 0.09892
K GSEEEDEDEDEEQDER Q 2 0.391 0.23484
K EEDEGEQPRPFPFPRPR Q 0 0.402 0.36612
K EEDEDEQPRPIPFPRPQPR Q 0 0.549 0.36626
R VLFGEEEEQR Q 2 0.482 0.5588
R VLLGEEEEQR Q 1 0.458 0.60052
K NPFHFNSK R 2 0.35 0.37964
R ESEESEDSELR R 3 0.312 0.20436
K DIENLIK S 2 0.241 0.33982
K TISSEDKPFNLR S 5 0.249 0.72024
K TISSEDEPFNLR S 2 0.676 0.86936
R EDENNPFYFR S 1 0.606 0.35834
R EDENNPFYLR S 1 0.595 0.41844
K NQYGHVR V 1 0.28 0.09148
R FPLLVLLGTVFLASVCVSLK V 0 0.377 0.11506
R LQSGDALR V 1 0.275 0.61718
R DSYNLQSGDALR V 4 0.653 0.6371
K QEEEPLEVQR Y 2 0.382 0.40604
K LAIPVNKPGR Y 1 0.298 0.5279

1 Previous amino acid (^ = Start of protein)

2 Next amino acid ($ = End of protein)

3 Exp. = Number of publications in which this peptide has been reported experimentally

4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.