If you found this site useful, please cite: Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Soy Protein: Gly m 6 | Glycinin (Legumin, 11S Globulin)

Isoform:

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 495 amino acids

MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA

UniProt: P04776   IUIS: Gly m 6

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 485 amino acids

MAKLVLSLCFLLFSGCFALREQAQQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQRGRSQRPQDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAPEFLKEAFGVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQRRAVA

UniProt: P04405   IUIS: Gly m 6

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 481 amino acids

MAKLVLSLCFLLFSGCCFAFSFREQPQQNECQIQRLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNAPQEIYIQQGSGIFGMIFPGCPSTFEEPQQKGQSSRPQDRHQKIYHFREGDLIAVPTGFAYWMYNNEDTPVVAVSLIDTNSFQNQLDQMPRRFYLAGNQEQEFLQYQPQKQQGGTQSQKGKRQQEEENEGGSILSGFAPEFLEHAFVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRPEEEEKPDCDEKDKHCQSQSRNGIDETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDFPALSWLKLSAQFGSLRKNAMFVPHYNLNANSIIYALNGRALVQVVNCNGERVFDGELQEGQVLIVPQNFAVAARSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQQTFNLRRQQARQVKNNNPFSFLVPPKESQRRVVA

UniProt: P11828   IUIS: Gly m 6

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 563 amino acids

MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYLKDVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQGSPRVKVA

UniProt: Q9SB11   IUIS: Gly m 6

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 517 amino acids

MGKPFFTLSLSSLCLLLLSSACFAITSSKFNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSSRRGSRSQQQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQQQQQQKSHGGRKQGQHQQQEEEGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQTPSYPPRRPSHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYIKDVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP

UniProt: Q7GC77   IUIS: Gly m 6

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:
Peptide Characteristics:

Minimum length:

Maximum length:

1Peptide2Exp.3ESP4CONSeQ5
K YQGNSGPLVNP $ 1 0.444 0.47664
K NAMFVPHYTLNANSIIYALNGR A 4 0.504 0.05638
K NAMFVPHYNLNANSIIYALNGR A 3 0.516 0.07818
K LHENIARPSR A 0 0.217 0.28564
R ADFYNPK A 3 0.23 0.33692
R IESEGGFIETWNPNNKPFQCAGVALSR C 1 0.384 0.14994
R IESEGGLIETWNPNNKPFQCAGVALSR C 3 0.457 0.16818
R VESEGGLIQTWNSQHPELK C 4 0.717 0.35252
K THHNAVSSYIK D 2 0.536 0.1664
K THHNAVTSYLK D 3 0.507 0.16722
K GGLSVISPPTEEQQQRPEEEEKPDCDEK D 0 0.622 0.37682
K LVFSLCFLLFSGCCFAFSSR E 0 0.199 0.10232
K LVLSLCFLLFSGCCFAFSFR E 0 0.15 0.11016
K LVLSLCFLLFSGCFALR E 0 0.186 0.14108
K QQEEENEGSNILSGFAPEFLK E 4 0.715 0.33498
K NNNPFSFLVPPK E 2 0.767 0.53518
^ MGKPFFTLSLSSLCLLLLSSACFAITSSK F 0 0.219 0.06612
K NGIYSPHWNLNANSVIYVTR G 3 0.495 0.13076
K NLQGENEGEDK G 3 0.337 0.13854
K QQGGTQSQK G 0 0.261 0.16086
K LQGENEEEEK G 0 0.248 0.21202
K YQQEQGGHQSQK G 3 0.36 0.22192
K GIFGMIYPGCPSTFEEPQQPQQR G 5 0.823 0.2694
K YQQQQQGGSQSQK G 2 0.376 0.29032
K GAIVTVK G 1 0.22 0.53132
R NGIYSPHWNLNANSVIYVTR G 3 0.495 0.13076
R NGLHLPSYSPYPQMIIVVQGK G 2 0.664 0.17478
R KPQQEEDDDDEEEQPQCVETDK G 2 0.654 0.29266
R MIIIAQGK G 3 0.231 0.3763
R RPSYTNGPQEIYIQQGK G 4 0.383 0.39378
R NLQGENEEEDSGAIVTVK G 4 0.698 0.6282
K GQSSRPQDR H 0 0.227 0.1055
K QGQHQQEEEEEGGSVLSGFSK H 2 0.618 0.4692
K QGQHQQQEEEGGSVLSGFSK H 2 0.606 0.48408
R GQSSRPQDR H 0 0.227 0.1055
R SQRPQDR H 0 0.211 0.1078
K QQLQDSHQK I 0 0.236 0.24112
K LNALKPDNR I 3 0.232 0.39334
R SQQQLQDSHQK I 3 0.306 0.2469
R LNALKPDNR I 3 0.232 0.39334
K LQSPDDER K 2 0.225 0.13154
K LSAQFGSLR K 4 0.464 0.67048
K LSAQYGSLR K 3 0.394 0.6995
R VTAPAMR K 0 0.245 0.23516
R EQDQDQDEDEDEDEDQPR K 2 0.584 0.2822
R LSAEFGSLR K 7 0.476 0.66494
K CAGVTVSK L 3 0.242 0.32188
K HFLAQSFNTNEDIAEK L 4 0.753 0.39634
K HFLAQSFNTNEDTAEK L 3 0.729 0.50976
R NGIDETICTMR L 0 0.399 0.30478
R NGVEENICTMK L 1 0.324 0.30844
R EQPQQNECQIQR L 2 0.367 0.36888
R EQPQQNECQIQK L 3 0.331 0.38698
R EQAQQNECQIQK L 2 0.321 0.4056
R NGVEENICTLK L 1 0.485 0.56692
^ MGKPFTLSLSSLCLLLLSSACFAISSSK L 0 0.209 0.0828
R NGLHLPSYSPYPR M 3 0.684 0.35168
K HCQSQSR N 0 0.165 0.07498
K EAFGVNMQIVR N 8 0.482 0.42222
R QFGLSAQYVVLYR N 3 0.398 0.22462
R QFQLSAQYVVLYK N 3 0.406 0.28524
K HQQEEENEGGSILSGFTLEFLEHAFSVDK Q 5 0.481 0.15014
R QQEEENEGGSILSGFAPEFLEHAFVVDR Q 4 0.563 0.1525
R AIPSEVLSNSYNLGQSQVR Q 1 0.678 0.19406
R FYLAGNQEQEFLQYQPQK Q 3 0.644 0.26782
R ISTLNSLTLPALR Q 6 0.629 0.59184
R AIPSEVLAHSYNLR Q 5 0.695 0.69544
K WQEQQDEDEDEDEDDEDEQIPSHPPR R 3 0.478 0.31158
K WQEQEDEDEDEDEEYEQTPSYPPR R 2 0.475 0.318
K GAIGFAFPGCPETFEKPQQQSSR R 3 0.623 0.46682
K GALGVAIPGCPETFEEPQEQSNR R 0 0.861 0.50626
K NNNPFSFLVPPQESQR R 2 0.864 0.56882
K FLVPPQESQK R 1 0.473 0.68128
R VESEGGLIETWNSQHPELQCAGVTVSK R 2 0.578 0.21822
R EQDEDEDEDEDKPRPSRPSQGK R 0 0.317 0.24334
R VVNCQGNAVFDGELR R 3 0.565 0.6076
R VFDGELQEGQVLIVPQNFAVAAR S 1 0.608 0.03558
R VFDGELQEGGVLIVPQNFAVAAK S 4 0.654 0.04414
R VFYLAGNPDIEYPETMQQQQQQK S 4 0.699 0.29392
R VLIVPQNFVVAAR S 8 0.641 0.2974
R VFYLAGNPDIEHPETMQQQQQQK S 3 0.647 0.37258
K SQSDNFEYVSFK T 8 0.626 0.4661
R GQLLVVPQNFVVAEQAGEQGFEYIVFK T 3 0.368 0.04948
R GQLLVVPQNFVVAEQGGEQGLEYVVFK T 1 0.424 0.0625
R SQSDNFEYVSFK T 8 0.626 0.4661
K FNECQLNNLNALEPDHR V 2 0.622 0.33638
K LNECQLNNLNALEPDHR V 2 0.63 0.39096
K YEGNWGPLVNPESQQGSPR V 4 0.819 0.5185
R ALIQVVNCNGER V 3 0.615 0.6837
R ALVQVVNCNGER V 2 0.574 0.68858
R VFDGELQEGR V 9 0.538 0.736
K QIVTVEGGLSVISPK W 4 0.766 0.92768
R FYLAGNQEQEFLK Y 5 0.605 0.37508
R QSQVSELK Y 2 0.235 0.38848

1 Previous amino acid (^ = Start of protein)

2 Next amino acid ($ = End of protein)

3 Exp. = Number of publications in which this peptide has been reported experimentally

4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.