If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SCGLAAK
Peptide within the protein Xip-g-1:
MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIEEDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALVTA
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide SCGLAAK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Glycine soja | Glycine soja | KHN09569 |
3848 |
| Amphidinium carterae | Amphidinium carterae | ABF57014 |
2961 |
| Brugia malayi | Brugia malayi | XP_001896251 XP_001902741 |
6279 |
| Equus asinus | Ass | XP_014688818 XP_014688814 XP_014688813 |
9793 |
| Glycine max | Soybean | NP_001236466 KHN09569 |
3847 |
| Gymnopus luxurians FD-317 M1 | Gymnopus luxurians fd-317 m1 | KIK66359 |
944289 |
| Kazachstania africana CBS 2517 | Kazachstania africana cbs 2517 | XP_003959871 |
1071382 |
| Kazachstania naganishii CBS 8797 | Kazachstania naganishii cbs 8797 | CCK68727 |
1071383 |
| Lachancea sp. KF-2015 | Lachancea sp. kf-2015 | CUS23098 |
1654605 |
| Opisthorchis viverrini | Opisthorchis viverrini | XP_009174817 |
6198 |
| Tetrapisispora blattae CBS 6284 | Tetrapisispora blattae cbs 6284 | XP_004181270 |
1071380 |
| Tetrapisispora phaffii CBS 4417 | Tetrapisispora phaffii cbs 4417 | XP_003683826 |
1071381 |
| Vigna angularis | Adzuki bean | XP_017437167 XP_017437164 |
3914 |
| Vigna angularis var. angularis | Vigna angularis var. angularis | XP_017437164 |
157739 |
| Xiphias gladius | Swordfish | CAR48256 |
8245 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.