If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: IGETLMR
Peptide within the protein Fag-t-2:
MKLFIILATATLLIAATQAKYLRDEGFDLGETQMSSKCTRQVKMMEPELVKCNRYIAMDIMDDKYEEALSRIQGEGCESEEKFLRGCCVAMKEMEDECVCEWMKMMVENQKGRIGETLMRKGIRDLKELPNKCGISEMECHSRGNWYYV
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide IGETLMR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Candidatus Methanomethylophilus sp. 1R26 | Candidatus methanomethylophilus sp. 1r26 | WP_058747688 |
1769296 |
| Fagopyrum tataricum | Tartarian buckwheat | ADW27428 |
62330 |
| Methanobrevibacter ruminantium | Methanobrevibacter ruminantium | WP_012955019 |
83816 |
| Methanobrevibacter ruminantium M1 | Methanobrevibacter ruminantium m1 | WP_012955019 |
634498 |
| Natrialba aegyptia | Natrialba aegyptia | WP_006665391 |
129789 |
| Natrialba aegyptia DSM 13077 | Natrialba aegyptia dsm 13077 | WP_006665391 |
1227491 |
| Natrialba asiatica | Natrialba asiatica | WP_006110987 |
64602 |
| Natrialba asiatica DSM 12278 | Natrialba asiatica dsm 12278 | WP_006110987 |
29540 |
| Physcomitrella patens | Physcomitrella patens | XP_001768254 |
3218 |
| Tetraodon nigroviridis | Spotted green pufferfish | CAF98721 |
99883 |
| Thermoplasmatales archaeon BRNA1 | Thermoplasmatales archaeon brna1 | WP_015492931 |
1054217 |
| Thermoplasmatales archaeon enrichment culture clone ISO4-H5 | Thermoplasmatales archaeon enrichment culture clone iso4-h5 | WP_066075368 |
1495144 |
| Trichinella pseudospiralis | Trichinella pseudospiralis | KRX98891 KRX98893 KRY90935 KRX98889 KRX98892 |
6337 |
| Vitrella brassicaformis CCMP3155 | Vitrella brassicaformis ccmp3155 | CEM19439 |
1169540 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.