Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Walnut Protein: Jug r 3 | Non-Specific Lipid Transfer Protein 1
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 139 amino acids
AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQSRSGGYDEDNQRQHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSARDLPNECGISSQRCEIRRSWF
UniProt: P93198 IUIS: Jug r 3Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| ^ | AALLVALLFVANAAAFR | T | 0 | 0.411 | 0.31232 |
| R | TTITTMEIDEDIDNPR | R | 0 | 0.707 | 0.4429 |
| R | QQNLNHCQYYLR | Q | 0 | 0.445 | 0.14396 |
| R | SGGYDEDNQR | Q | 0 | 0.334 | 0.14136 |
| R | QCCQQLSQMDEQCQCEGLR | Q | 0 | 0.322 | 0.27558 |
| R | QQQQQGLR | G | 0 | 0.253 | 0.31584 |
| R | GEEMEEMVQSAR | D | 0 | 0.324 | 0.55418 |
| R | DLPNECGISSQR | C | 0 | 0.547 | 0.66604 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.