If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: DLPNECGISSQR
Peptide within the protein Jug-r-3:
AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQSRSGGYDEDNQRQHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSARDLPNECGISSQRCEIRRSWF
References reporting this peptide:
- Heick J., et al. Application of a liquid chromatography tandem mass spectrometry method for the simultaneous detection of seven allergenic foods in flour and bread and comparison of the method with commercially available ELISA test kits.. Journal of AOAC International. 2011
Species Uniqueness
Species containing the peptide DLPNECGISSQR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Juglans regia | English walnut | AAB41308 AAB41308 |
51240 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.