If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: TTITTMEIDEDIDNPR
Peptide within the protein Jug-r-3:
AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQSRSGGYDEDNQRQHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSARDLPNECGISSQRCEIRRSWF
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Pecan | Car-i-1.0101 | 32201 |
| Walnut | Jug-n-1.0101 | 16719 |
| Walnut | Jug-r-1.0101 | 51240 |
| Walnut | Jug-r-3.0101 | 51240 |
Species containing the peptide TTITTMEIDEDIDNPR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Carya illinoinensis | Carya illinoinensis | AAO32314 AAO32314 AAO32314 AAO32314 |
32201 |
| Juglans nigra | Black walnut | AAM54365 AAM54365 AAM54365 AAM54365 |
16719 |
| Juglans regia | English walnut | AAB41308 AAB41308 AAB41308 AAB41308 |
51240 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.