Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VPVPQLQPQNPSQQQPQK
Peptide within the protein Wheat-gluten-A5JSB7:
MKTFLILALLAIVATTATIAVRVPVPQLQPQNPSQQQPQKQVPLVQQQQFPGQQQPFPPQQPYPQLQPFPSQQPYMQLQPFPQPQLPYPQPQLPYPQPQPFRPQQSYPQPQPQYSQPQQPISQQQQQQQQQQILQQILQQQLIPCRDVVLQQHSIAHGSSQVLQQSTYQLVQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQQQQQQQQQPLSQVCFQQSRQQYPSGQGSFQPSQQNPQAQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYCTIAPVGIFGTN
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide VPVPQLQPQNPSQQQPQK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Thinopyrum ponticum x Triticum aestivum | Thinopyrum ponticum x triticum aestivum | ABS72163 ABS72163 |
222994 |
| Triticum aestivum | Bread wheat | BAS02427 AFX69637 AKC91157 ABQ52128 AFX69578 AFX69616 ABS72143 ABB51640 AKC91134 AGO17666 AFQ13473 AKC91121 AFX69607 BAS02423 AKC91158 ACX71609 AGO17687 AHY37817 P04724 AFX69629 AFX69626 AFB35198 AGO17657 AFQ13476 AFQ13470 ABS72150 ABB51641 AFX69617 BAS02404 BAS02443 AKC91136 AHN85629 BAS02427 AFX69637 AKC91157 ABQ52128 AFX69578 AFX69616 ABS72143 ABB51640 AKC91134 AGO17666 AFQ13473 AKC91121 AFX69607 BAS02423 AKC91158 ACX71609 AGO17687 AHY37817 P04724 AFX69629 AFX69626 AFB35198 AGO17657 AFQ13476 AFQ13470 ABS72150 ABB51641 AFX69617 BAS02404 BAS02443 AKC91136 AHN85629 |
4565 |
| Triticum macha | Triticum macha | AKC91216 AKC91217 AKC91224 AKC91219 AKC91216 AKC91217 AKC91224 AKC91219 |
69994 |
| Triticum spelta | Triticum spelta | AKC91283 AKC91217 AKC91293 AKC91268 AKC91283 AKC91217 AKC91293 AKC91268 |
58933 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.