Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: QLNPSNK
Peptide within the protein Wheat-gluten-B6ETR9:
MARQLNPSNKELQSPQQSFSHQQQPFPQQPYPQQPYPSQQPYPSQQPFPTPQPQFPQQSQQPFTQPQQPTPLQPQQPFPQQPQQPQQPFPQPQQPFPWQPQQPFPQTQQSFPLQPQQPFPQQPQQPFPQPQLQFPQQPEQIIPQQPQQPFLLESQQPFPQQPQQPFPQPQQLIPMQPQQPFPQQSQQSQQPFPGPQQLFPELQQPIPQQPQQPFPLQPQQPFPQQSQQPFPQQPQQPCPLQPQQPFPQQPQQPFPQQPQQPFPLQPQQPFPLRPQQPFSQQPQQSQQSFPQPQPQQPQQPSILQPQQPFLQPQQQLSQQLEQTISQQPQQPFPQQPHQPQQPYPQQQPYGSSLTSIDGQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide QLNPSNK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Serpula lacrymans var. lacrymans S7.3 | Serpula lacrymans var. lacrymans s7.3 | EGN96199 EGN96199 |
936435 |
| Aegilops markgrafii | Aegilops markgrafii | AFV52229 AFV52228 AFV52225 AFV52227 AFV52226 AFV52229 AFV52228 AFV52225 AFV52227 AFV52226 |
4494 |
| Aegilops tauschii | Aegilops tauschii | AHJ60679 AEY70387 AHJ60679 AEY70387 |
37682 |
| Auricularia delicata TFB-10046 SS5 | Auricularia delicata tfb-10046 ss5 | XP_007345002 XP_007345002 |
717982 |
| Lophopyrum elongatum | Lophopyrum elongatum | ACN62218 ACN62218 |
4588 |
| Lottia gigantea | Owl limpet | XP_009053166 XP_009053166 |
225164 |
| Nadsonia fulvescens var. elongata DSM 6958 | Nadsonia fulvescens var. elongata dsm 6958 | ODQ63701 ODQ63701 |
857566 |
| Reticulomyxa filosa | Reticulomyxa filosa | ETO13260 ETO13260 |
46433 |
| Serpula lacrymans var. lacrymans S7.9 | Serpula lacrymans var. lacrymans s7.9 | XP_007321523 XP_007321523 |
578457 |
| Tetrahymena thermophila SB210 | Tetrahymena thermophila sb210 | XP_001027684 XP_001027684 |
312017 |
| Trichomonas vaginalis G3 | Trichomonas vaginalis g3 | XP_001315252 XP_001315252 |
412133 |
| Triticum aestivum | Bread wheat | AGZ20258 AGO17771 AGZ20257 AGZ20254 CAR82265 AGO17774 AGZ20258 AGO17771 AGZ20257 AGZ20254 CAR82265 AGO17774 |
4565 |
| Triticum aestivum x Lophopyrum elongatum | Triticum aestivum x lophopyrum elongatum | ACN62217 ACN62217 |
488177 |
| Triticum monococcum | Triticum monococcum | ADF58073 ADF58070 ADF58073 ADF58070 |
4568 |
| Triticum monococcum subsp. aegilopoides | Triticum monococcum subsp. aegilopoides | ADF58075 ADF58075 |
52163 |
| Triticum urartu | Triticum urartu | AKB95614 AKB95614 |
4572 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.