Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: NFLLQQCNPVSLVSSLISMILPR
Peptide within the protein Wheat-gluten-B6UKM8:
MKTLLILTILAMAITIGTANMQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQPQQPFPQQPQQPYPQQPQQPFPQPQQPQQQFPQSQQPQQPFPQPQQQFLQPQQPQQSFPQQQQPLIQLSLQQQMNPCKNFLLQQCNPVSLVSSLISMILPRSDCQVMQQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQEQRQGVQIRRPLFQLVQGQGIIQPQQPAQLEVIRSLVLRTLPTMCNVYVSPDCSTINAPFASIVVGIGGQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide NFLLQQCNPVSLVSSLISMILPR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops tauschii | Aegilops tauschii | AHJ60718 AHJ60716 AHJ60715 AHJ60713 AHJ60711 AHJ60708 AHJ60707 AHJ60705 AHJ60704 AHJ60702 AHJ60701 AHJ60698 AHJ60695 AHJ60694 AHJ60692 AHJ60691 AHJ60686 AHJ60685 AHJ60683 AHJ60682 AHJ60680 ACJ03466 ACJ03422 |
37682 |
| Aegilops uniaristata | Aegilops uniaristata | AEW46788 AEW46790 AEW46783 |
4492 |
| Australopyrum retrofractum | Australopyrum retrofractum | AEW46846 |
4597 |
| Triticum aestivum | Bread wheat | ABD98797 ACI04080 ACJ03454 ACX37111 ACJ03466 ACJ03422 ACJ03463 |
4565 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.