Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: APFSSVVAGIGGQ
Peptide within the protein Wheat-gluten-B6UKN9:
MKTLFILTILAMATTIATANMQVDPSGQVQWPQQQPFPQPQQPFCQQPQRTIPQPHQTFHHQPQQTFPQPQQTYPHQPQQQFPQTQQPQQPFPQPQQTFPQQPQLPFPQQRQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHTVIHSIIMQQEQQQGMHILLPLYQQQQVGQGTLVQGQGIIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVAGIGGQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide APFSSVVAGIGGQ are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Elymus stipifolius | Elymus stipifolius | AEW46800 AEW46800 |
120406 |
| Triticum aestivum | Bread wheat | ACJ03452 AAQ63859 CAC94868 CAC94870 CAC94871 BAN29066 CAC94869 AAD30440 AAD30556 AGO17717 AGO17695 ACJ03465 ACJ03452 AAQ63859 CAC94868 CAC94870 CAC94871 BAN29066 CAC94869 AAD30440 AAD30556 AGO17717 AGO17695 ACJ03465 |
4565 |
| Triticum aestivum x Lophopyrum elongatum | Triticum aestivum x lophopyrum elongatum | ACI04108 ACI04111 ACI04109 ACI04108 ACI04111 ACI04109 |
488177 |
| Triticum spelta | Triticum spelta | AAD30440 AAD30440 |
58933 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.