If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: NFLLQQCNHVSLVSSLVSIILPR
Peptide within the protein Wheat-gluten-B6UKP7:
MKTLLILTILAMATTIATANMQVDPSGQVQWPQQQPFPQPQQPFCQQPQRTIPQPHQTFHHQPQQTFPQPQQTYPHQPQQQFPQPQQPQQSFPQQQQPAIQSFLQQQMNPCKNFLLQQCNHVSLVSSLVSIILPRSDCQVMQQQCCQQLAQIPQQLQCAAIHSVAHSIIMQQEQQQGVPILRPLFQLAQGLGIIQPQQPAQLEGIRSLVLKTLPTMCNVYVPPDCSTINAPFASIVVGIGGQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide NFLLQQCNHVSLVSSLVSIILPR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Triticum aestivum | Bread wheat | AAK84775 ACJ03459 ACJ03473 ACJ03474 AGO17703 ACW82492 ACJ03461 ACJ03453 ACJ03451 AGO17706 AGO17704 AGO17700 AGO17699 AGJ50342 AFX69676 P21292 AAK84777 AAK84775 ACJ03459 ACJ03473 ACJ03474 AGO17703 ACW82492 ACJ03461 ACJ03453 ACJ03451 AGO17706 AGO17704 AGO17700 AGO17699 AGJ50342 AFX69676 P21292 AAK84777 |
4565 |
| Triticum durum | Durum wheat | CAA37491 CAA54925 CAA37491 CAA54925 |
4567 |
| Triticum turgidum | Triticum turgidum | ACJ03441 CAA37491 P21292 ACJ03441 CAA37491 P21292 |
4571 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.