Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VDQPTSCQNVQHQCCR
Peptide within the protein Wheat-gluten-B8YG97:
MKVFILALLALTATTAIAQLDTTCSQGFRQYQQQQQPGQRQLLEQMRPCVAFLQQQCRPLRMPFLQTQVEQLSSCQIDQYQCCQQLAQIPEQIRCHAIHNVVEAIMQQQSQQHRQERQQQAQHKSMRMLLETLYLMCNIYVPIQCQQQQQLGQQQQQQLQEQLTPCATFLQHQCSPVTVPFPQIRVDQPTSCQNVQHQCCRQLSQIPEQYRCQAIHNVAEAIRHQQPQQQCQGMYQPQQPAKLESIRMSLQALRSMCRIYIPVQCPAPTAYNIPMVATYTGGAC
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide VDQPTSCQNVQHQCCR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops bicornis | Aegilops bicornis | CAJ32659 |
4483 |
| Aegilops biuncialis | Aegilops biuncialis | ABU89780 |
130455 |
| Aegilops columnaris | Aegilops columnaris | ABU89779 |
4493 |
| Aegilops crassa | Aegilops crassa | ABU89788 |
4481 |
| Aegilops cylindrica | Aegilops cylindrica | ABU89782 CAJ32659 |
130456 |
| Aegilops longissima | Aegilops longissima | CAJ32659 |
4486 |
| Aegilops markgrafii | Aegilops markgrafii | CAJ32661 |
4494 |
| Aegilops neglecta | Aegilops neglecta | ABU89778 |
130460 |
| Aegilops searsii | Aegilops searsii | AHA61691 AHA61690 AHA61689 |
4487 |
| Aegilops tauschii | Aegilops tauschii | EMT27297 ANJ76767 ABU89787 ALT08047 ALT08045 ALT08044 ALT08042 ALT08041 ALT08040 CAJ32659 AHA61695 AHA61694 AHA61693 AHA61692 ALT08048 |
37682 |
| Aegilops triuncialis | Aegilops triuncialis | ABU89781 |
39391 |
| Aegilops triuncialis var. persica | Aegilops triuncialis var. persica | AHA61697 AHA61696 |
1424572 |
| Aegilops umbellulata | Aegilops umbellulata | CAJ32659 |
4491 |
| Aegilops ventricosa | Aegilops ventricosa | ABU89790 |
116981 |
| Amblyopyrum muticum | Amblyopyrum muticum | ABU89783 |
4595 |
| Brachypodium distachyon | Brachypodium distachyon | AHL38533 AHL38532 AHL38530 AHL38529 AHL38528 AHL38527 |
15368 |
| Hordeum vulgare | Hordeum vulgare | ABU89795 |
4513 |
| Triticum aestivum | Bread wheat | ANG56518 ANG56521 ANG56520 ANG56519 A7XUQ5 A5A4L5 A5A4L4 D6QZM8 D6QZM5 D0EWS4 B8YG97 AHA61703 AHA61702 AHA61701 AHA61700 AHA61699 AHA61698 AEW43833 AEW43832 AEW43829 AEW43827 AEW43825 AEW43824 AEW43822 AEW43819 AEW43816 P0CZ06 Q2A783 P0CZ05 |
4565 |
| Triticum dicoccoides | Triticum dicoccoides | ABU89793 |
85692 |
| Triticum monococcum | Triticum monococcum | AHA61688 AHA61687 AHA61686 AHA61685 AHA61684 |
4568 |
| Triticum urartu | Triticum urartu | EMS54755 |
4572 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.