Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SIYIPVQCPAPTTYNIPLVATYTGGAC
Peptide within the protein Wheat-gluten-D6QZM8:
MKVFILALLALAATTAIAQLETTCSQGFGQSQQQQQPGQRQLLEQMKPCVAFLQQKCSPLRMPFLQTQVEQLSSCQIVQYQCCQQLAQIPERTRCHAIHIVVEAIIQQQSQQQWQEPQQQAQHKSMRMLLENLSLMCNIYVPVQCQQQQQLGQQQQQQLQEQLTPCTTFLQQQCSPVTVPFPQIPVDQPTSCQNVQHQCCRQLSQIPEQFRCQAIHNVAEAIRQQQPQQQWQGMYQPQQPAQLESIRMSLQALRSMRSIYIPVQCPAPTTYNIPLVATYTGGAC
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide SIYIPVQCPAPTTYNIPLVATYTGGAC are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops tauschii | Aegilops tauschii | ANJ76767 ALT08047 ALT08045 |
37682 |
| Brachypodium distachyon | Brachypodium distachyon | AHL38528 |
15368 |
| Triticum aestivum | Bread wheat | A5A4L4 D6QZM8 D6QZM5 D6QZM4 D0EWS4 AHA61703 AHA61702 AHA61701 AHA61700 AEW43833 AEW43832 AEW43829 AEW43827 AEW43825 AEW43824 AEW43822 AEW43819 AEW43816 |
4565 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.