LEGGDALLASQ peptide from Wheat-gluten-P02861

If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Peptide: LEGGDALLASQ

Peptide within the protein Wheat-gluten-P02861:

EKLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ

References reporting this peptide:

None.

Species Uniqueness

Species containing the peptide LEGGDALLASQ are presented below. Accessions and taxid values link to further information hosted on NCBI.

Species name	Common name	Accession(s)	Tax ID
Secale cereale	Rye	CAC40673 CAC40683 CAC40673 CAC40683	4550
Secale cereale subsp. dighoricum	Secale cereale subsp. dighoricum	CAC40677 CAC40677	155093
Triticum aestivum	Bread wheat	P02861 CAC83002 AAF23506 ABK54365 AAB02788 BAN82580 ABF82252 AKW50842 AKW50841 AHZ62762 CAA43331 AKW50839 AEO19857 P02861 CAC83002 AAF23506 ABK54365 AAB02788 BAN82580 ABF82252 AKW50842 AKW50841 AHZ62762 CAA43331 AKW50839 AEO19857	4565
Triticum aestivum x Secale cereale	Triticum aestivum x secale cereale	ADY38704 ADY38716 ADY38717 ADY38715 ADY38714 ADY38713 ADY38711 ADY38703 ADY38702 ADY38701 ADY38697 ADY38718 ADY38698 ADY38710 ADY38707 ADY38705 ADY38709 ADY38708 ADY38695 ADY38706 ADY38712 ADY38700 ADY38699 ADY38694 ADY38693 ADY38696 ADY38692 ADY38704 ADY38716 ADY38717 ADY38715 ADY38714 ADY38713 ADY38711 ADY38703 ADY38702 ADY38701 ADY38697 ADY38718 ADY38698 ADY38710 ADY38707 ADY38705 ADY38709 ADY38708 ADY38695 ADY38706 ADY38712 ADY38700 ADY38699 ADY38694 ADY38693 ADY38696 ADY38692	49318
Triticum dicoccoides	Triticum dicoccoides	ANJ03342 AKW50840 ANJ03342 AKW50840	85692
Triticum monococcum	Triticum monococcum	ACJ76970 ACJ76970	4568
Triticum monococcum subsp. monococcum	Triticum monococcum subsp. monococcum	AKI85256 AKI85240 AKI85238 ALC74299 ALC74298 ALC74297 ALC74296 ALC74295 ALC74294 ALC74293 ALC74292 AKI85256 AKI85240 AKI85238 ALC74299 ALC74298 ALC74297 ALC74296 ALC74295 ALC74294 ALC74293 ALC74292	408188
Triticum polonicum	Triticum polonicum	ACZ49742 ACZ49742	77606
Triticum timopheevii	Triticum timopheevii	CAC38045 CAC38045	4570
Triticum urartu	Triticum urartu	AFP58876 AFP58872 AFP58866 AFP58864 AFP58862 AFP58856 AFG73685 EMS67071 AFP58876 AFP58872 AFP58866 AFP58864 AFP58862 AFP58856 AFG73685 EMS67071	4572

BLAST non-redundant protein database version: 4, date: December 9, 2015.

See the About page for more information.