Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: TFLILALLAIVATTATSAVR
Peptide within the protein Wheat-gluten-P04723:
MKTFLILALLAIVATTATSAVRVPVPQLQPQNPSQQQPQEQVPLMQQQQQFPGQQEQFPPQQPYPHQQPFPSQQPYPQPQPFPPQLPYPQTQPFPPQQPYPQPQPQYPQPQQPISQQQAQQQQQQQQTLQQILQQQLIPCRDVVLQQHNIAHASSQVLQQSSYQQLQQLCCQQLFQIPEQSRCQAIHNVVHAIILHHHQQQQQQPSSQVSYQQPQEQYPSGQVSFQSSQQNPQAQGSVQPQQLPQFQEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFGTN
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide TFLILALLAIVATTATSAVR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Thinopyrum ponticum x Triticum aestivum | Thinopyrum ponticum x triticum aestivum | ABS72156 |
222994 |
| Aegilops tauschii | Aegilops tauschii | EMT07317 |
37682 |
| Triticum aestivum | Bread wheat | ABS72156 AGO17683 AFX69640 AFX69614 P04723 AFX69636 AKC91125 AGO17663 |
4565 |
| Triticum macha | Triticum macha | ABS72156 |
69994 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.