Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: TLPTMCSVNVPLYSATTSVPFGVGTGVGAY
Peptide within the protein Wheat-gluten-P04729:
MKTFLVFALIAVVATSAIAQMETSCISGLERPWQQQPLPPQQSFSQQPPFSQQQQQPLPQQPSFSQQQPPFSQQQPILSQQPPFSQQQQPVLPQQSPFSQQQQLVLPPQQQQQQLVQQQIPIVQPSVLQQLNPCKVFLQQQCSPVAMPQRLARSQMWQQSSCHVMQQQCCQQLQQIPEQSRYEAIRAIIYSIILQEQQQGFVQPQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQQLGQQPQQQQQQQVLQGTFLQPHQIAHLEAVTSIALRTLPTMCSVNVPLYSATTSVPFGVGTGVGAY
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide TLPTMCSVNVPLYSATTSVPFGVGTGVGAY are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops cylindrica | Aegilops cylindrica | ACV32577 ACV32577 |
130456 |
| Aegilops tauschii | Aegilops tauschii | AFX69647 AAT37860 AFX69661 AFX69652 AFX69649 ABB90585 ACY08825 EMT31216 AFK13666 ADH51276 AFX69657 ADH51277 AFX69656 AFX69647 AAT37860 AFX69661 AFX69652 AFX69649 ABB90585 ACY08825 EMT31216 AFK13666 ADH51276 AFX69657 ADH51277 AFX69656 |
37682 |
| Thinopyrum ponticum x Triticum aestivum | Thinopyrum ponticum x triticum aestivum | AAZ76360 AAZ76360 |
222994 |
| Triticum aestivum | Bread wheat | AAN32705 AGU91670 AAV92009 AAV92008 ACY08817 AGK83322 AGU91699 AEI00667 ACZ63204 ALN96401 BAB78758 AGO17759 AFX69669 AFX69666 AFL55408 AEI00666 ABG76008 AAV92007 AAV92005 AGU91672 P04729 AFB35202 AAA34286 AAN32705 AGU91670 AAV92009 AAV92008 ACY08817 AGK83322 AGU91699 AEI00667 ACZ63204 ALN96401 BAB78758 AGO17759 AFX69669 AFX69666 AFL55408 AEI00666 ABG76008 AAV92007 AAV92005 AGU91672 P04729 AFB35202 AAA34286 |
4565 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.