Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: APFASIVASIGGQ
Peptide within the protein Wheat-gluten-P06659:
MKTLLILTILAMAITIATANMQADPSGQVQWPQQQPFLQPHQPFSQQPQQIFPQPQQTFPHQPQQQFPQPQQPQQQFLQPRQPFPQQPQQPYPQQPQQPFPQTQQPQQPFPQSKQPQQPFPQPQQPQQSFPQQQPSLIQQSLQQQLNPCKNFLLQQCKPVSLVSSLWSIILPPSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQEQQEQLQGVQILVPLSQQQQVGQGILVQGQGIIQPQQPAQLEVIRSLVLQTLPTMCNVYVPPYCSTIRAPFASIVASIGGQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide APFASIVASIGGQ are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Elymus stipifolius | Elymus stipifolius | AEW46801 |
120406 |
| Triticum aestivum | Bread wheat | ACJ03480 ACJ03468 ACJ03472 P06659 ADZ76044 AEA30014 ACJ03460 ACJ03453 ACJ03478 |
4565 |
| Triticum aestivum x Lophopyrum elongatum | Triticum aestivum x lophopyrum elongatum | ACI04106 ACI04099 |
488177 |
| Triticum dicoccoides | Triticum dicoccoides | ACJ03428 |
85692 |
| Triticum turgidum | Triticum turgidum | ACJ03449 ACJ03446 ACJ03439 |
4571 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.