Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: NFLLQQCKPVSLVSSLWSIILPPSDCQVMR
Peptide within the protein Wheat-gluten-P06659:
MKTLLILTILAMAITIATANMQADPSGQVQWPQQQPFLQPHQPFSQQPQQIFPQPQQTFPHQPQQQFPQPQQPQQQFLQPRQPFPQQPQQPYPQQPQQPFPQTQQPQQPFPQSKQPQQPFPQPQQPQQSFPQQQPSLIQQSLQQQLNPCKNFLLQQCKPVSLVSSLWSIILPPSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQEQQEQLQGVQILVPLSQQQQVGQGILVQGQGIIQPQQPAQLEVIRSLVLQTLPTMCNVYVPPYCSTIRAPFASIVASIGGQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide NFLLQQCKPVSLVSSLWSIILPPSDCQVMR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Australopyrum retrofractum | Australopyrum retrofractum | AEW46842 AEW46820 |
4597 |
| Triticum aestivum | Bread wheat | ACJ03480 AAQ63856 P06659 ADZ76044 ACJ03460 ACJ03478 |
4565 |
| Triticum aestivum x Lophopyrum elongatum | Triticum aestivum x lophopyrum elongatum | ACI04106 ACI04099 |
488177 |
| Triticum dicoccoides | Triticum dicoccoides | ACJ03428 |
85692 |
| Triticum durum | Durum wheat | AAQ63864 AAQ63861 |
4567 |
| Triticum macha | Triticum macha | ACM41414 |
69994 |
| Triticum turgidum | Triticum turgidum | ACJ03446 ACJ03439 |
4571 |
| Triticum turgidum subsp. durum x Hordeum chilense | Triticum turgidum subsp. durum x hordeum chilense | AAQ63865 |
49967 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.