Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: TFLVFALLAVAATSAIAQMETR
Peptide within the protein Wheat-gluten-P10386:
MKTFLVFALLAVAATSAIAQMETRCIPGLERPWQQQPLPPQQTFPQQPLFSQQQQQQLFPQQPSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQQQLVLPQQPPFSQQQQPVLPPQQSPFPQQQQQHQQLVQQQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFGVGTGVGAY
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide TFLVFALLAVAATSAIAQMETR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops cylindrica | Aegilops cylindrica | ACV32578 |
130456 |
| Aegilops tauschii | Aegilops tauschii | AFX69658 ABB90587 ABB90586 ABB90584 ACY08826 AFX69665 AFX69664 AFX69646 AFX69644 AFX69643 AFX69642 AAT37863 ADH51276 AFX69663 |
37682 |
| Aegilops tauschii x Triticum turgidum | Aegilops tauschii x triticum turgidum | AAT76906 |
285950 |
| Elymus spicatus | Elymus spicatus | P10386 |
4604 |
| Thinopyrum ponticum x Triticum aestivum | Thinopyrum ponticum x triticum aestivum | AAV75997 ABV72251 ABV72240 AAZ76362 AAV75998 |
222994 |
| Triticum aestivum | Bread wheat | AGU91679 ACO70858 AGU91664 AGO17751 AFX69669 AAV92017 CAD58619 ACI04536 ACF93464 AAP87371 BAB78761 AGU91705 AGO31304 AFB35207 ACC60298 ABY41262 AAV92058 AAV92020 AAS66084 ALN96395 ALN96392 AGO17744 ABG76009 ALN96394 P10386 ACX46518 ACM77758 AGO31302 AGO17747 AGO17740 AFB35204 AFB35203 AEI00688 AEI00687 AEI00686 AEI00685 AEI00684 AED99854 ABM73528 ABM73529 AHN55175 AGU91666 AGK83314 ACF93468 AGU91694 |
4565 |
| Triticum macha | Triticum macha | ACM41419 ACM66928 |
69994 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.