Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SQMLQQSSCHVMQQQCCQQLPQIPEQSR
Peptide within the protein Wheat-gluten-P16315:
MKTFLVFALLAVVATSTIAQMETSCIPGLERPWQEQPLPPQHTLFPQQQPFPQQQQPPFSQQQPSFLQQQPILPQLPFSQQQQPVLPQQSPFSQQQLVLPPQQQYQQVLQQQIPIVQPSVLQQLNPCKVFLQQQCNPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPEQSRYDVIRAITYSIILQEQQQGFVQAQQQQPQQLGQGVSQSQQQSQQQLGQCSFQQPQQQLGQQPQQQQVLQGTFLQPHQIAHLEVMTSIALRTLPTMCSVNVPLYSSTTSVPFSVGTGVGAYL
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide SQMLQQSSCHVMQQQCCQQLPQIPEQSR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Triticum durum | Durum wheat | P16315 |
4567 |
| Dasypyrum villosum | Dasypyrum villosum | AFO85399 |
40247 |
| Elymus spicatus | Elymus spicatus | AHY86052 |
4604 |
| Leymus mollis | Leymus mollis | ACS36767 |
183794 |
| Lophopyrum elongatum | Lophopyrum elongatum | ACF42097 ACF42092 ACF42087 ACF42090 ACF42088 ACF42089 ACF42095 |
4588 |
| Psathyrostachys juncea | Psathyrostachys juncea | AEJ91540 |
4586 |
| Thinopyrum intermedium | Thinopyrum intermedium | AAO53261 |
85679 |
| Triticum aestivum | Bread wheat | P16315 |
4565 |
| Triticum aestivum/Thinopyrum intermedium alien addition line | Triticum aestivum/thinopyrum intermedium alien addition line | AAO53265 |
218488 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.