Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: QLLEQMKPCVAFLQQQCRPLR
Peptide within the protein Wheat-gluten-Q2A783:
MKVFILALLALTATTAIAQLETTCSQGFGQYQQQQQPGQRQLLEQMKPCVAFLQQQCRPLRMPFLQTQVEQLSSCQIVQHQCCQQLAQIPERIRCHAIHSVVEAIMQQQSQQQWQERQQQAQHKSMRMLLENLSLMCNIYVPVQCQQQQQMGQQQQQQQLQEQLTPCATFLQHQCSPVTVPFPQIPVDQPTSCQNVQHQCCRQLSQIPEQFRCQAIHNVAEAIRQQQPQQQWQGMYQPQQPAQHESIRMSLQALRSMCNIYIPVQCPAPTAYNIPMVATCTSGAC
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide QLLEQMKPCVAFLQQQCRPLR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Triticum aestivum | Bread wheat | AAP80606 ANG56520 Q2A783 |
4565 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.