If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: QQQGQSFGQPQQQVPVEIMR
Peptide within the protein Wheat-gluten-Q2A784:
MKTMFLLALLAFTATSAVAQLYTTCSQGYGQCQQQPQPQPQPQPQMNTCAAFLQQCSQTPHVQTQMWQASGCQLVRQQCCQPLAQISEQARCQAVCSVAQIIMRQQQGQSFGQPQQQVPVEIMRMVLQTLPLMCRVNIPQYCTTTPCSTITPAIYSIPMTATCAGGAC
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide QQQGQSFGQPQQQVPVEIMR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops cylindrica | Aegilops cylindrica | CAJ32656 |
130456 |
| Aegilops tauschii | Aegilops tauschii | EMT27294 CAJ32657 |
37682 |
| Triticum aestivum | Bread wheat | Q2A784 P0CZ08 P0CZ07 |
4565 |
| Triticum urartu | Triticum urartu | EMS63286 |
4572 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.