Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: NFLLQQCKPVSLVSSLWSMILPR
Peptide within the protein Wheat-gluten-Q41543:
NIQVDPSGQVQWPQQQPFPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFSQPQQPQQQFIQPQQPFPQQPQQTYPQRPQQPFPQTQQPQQPFPQSQQPQQPFPQPQQQFPQPQQPQQSFPQQQPSLIQQSLQQQLNPCKNFLLQQCKPVSLVSSLWSMILPRSDCQVMRQQCCQQLAQIPQQLQCAAIHSIVHSIIMQQEQQEQRQGVQILVPLSQQQQVGQGTLVQGQGIIQPQQPAQLEVIRSSVLQTLATMCNVYVPPYCSTIRAPFASIVAGIGGQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide NFLLQQCKPVSLVSSLWSMILPR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops speltoides | Aegilops speltoides | AFQ20221 |
4573 |
| Aegilops tauschii | Aegilops tauschii | AEA30013 AGC65443 |
37682 |
| Amblyopyrum muticum | Amblyopyrum muticum | AFQ20172 AFQ20174 AFQ20173 |
4595 |
| Australopyrum retrofractum | Australopyrum retrofractum | AEW46843 |
4597 |
| Triticum aestivum | Bread wheat | AAQ63857 CAB75404 BAA11251 AAQ63860 ADZ76045 ADZ76043 ACX37115 AEX91927 AAK84778 ACX37113 |
4565 |
| Triticum aestivum x Lophopyrum elongatum | Triticum aestivum x lophopyrum elongatum | ACI04110 ACI04098 |
488177 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.