Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: APFASIVAGIGGQYR
Peptide within the protein Wheat-gluten-Q6EEW9:
MNIQVDPSSQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNPCKNILLQQCKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGMHIFLPLSQQQQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQYR
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide APFASIVAGIGGQYR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops tauschii | Aegilops tauschii | AFC98441 AFC98440 |
37682 |
| Aegilops tauschii x Secale cereale | Aegilops tauschii x secale cereale | AFH74436 AFH74432 AFH74437 AFH74433 AFC98440 |
1158823 |
| Triticum aestivum | Bread wheat | AAQ63857 AFC98438 AFC98437 AFC98436 AFC98435 AED99849 AAQ63856 CAB75404 ACI04086 ACI04083 AAQ63860 ACI04087 ACI04084 ACI04088 ACI04085 ACI04082 AAQ63858 AED99848 |
4565 |
| Triticum aestivum x Lophopyrum elongatum | Triticum aestivum x lophopyrum elongatum | ACI04105 ACI04103 ACI04098 ACI04100 ACI04102 ACI04107 ACI04104 ACI04097 |
488177 |
| Triticum durum | Durum wheat | AAQ63862 AAQ63864 AAQ63863 AAQ63861 |
4567 |
| Triticum monococcum | Triticum monococcum | AED99849 |
4568 |
| Triticum turgidum subsp. durum x Hordeum chilense | Triticum turgidum subsp. durum x hordeum chilense | AAQ63865 |
49967 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.