Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: NILLQQCKPASLVSSLWSIIWPQSDCQVMR
Peptide within the protein Wheat-gluten-Q6EEW9:
MNIQVDPSSQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNPCKNILLQQCKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGMHIFLPLSQQQQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQYR
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide NILLQQCKPASLVSSLWSIIWPQSDCQVMR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops bicornis | Aegilops bicornis | ACJ03536 |
4483 |
| Aegilops cylindrica | Aegilops cylindrica | AFC75726 |
130456 |
| Aegilops sharonensis | Aegilops sharonensis | ACJ03542 |
58530 |
| Aegilops tauschii | Aegilops tauschii | AFQ20228 AFC75725 AEA52220 AEA52221 AGC65441 EMT15786 |
37682 |
| Aegilops uniaristata | Aegilops uniaristata | AEW46784 AEW46786 AAK84779 |
4492 |
| Triticum aestivum | Bread wheat | ACX37114 AAF42989 ACI04084 ACI04085 ACI04082 AAQ63858 AFC75727 ACJ03464 ACJ03456 AGZ20273 AGO17729 AGO17715 AGO17714 AGO17713 AGO17705 AGO17698 AGO17694 AGO17690 AFX69687 AEA52221 AEA52219 AEA52218 AEA30015 AAK84779 |
4565 |
| Triticum aestivum x Lophopyrum elongatum | Triticum aestivum x lophopyrum elongatum | ACI04103 ACI04102 ACI04107 ACI04104 ACI04097 |
488177 |
| Triticum macha | Triticum macha | ACM41415 |
69994 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.