Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SQMWQQSSCHVMQQQCCQQLSQIPEQSR
Peptide within the protein Wheat-gluten-Q8H0J4:
SHIPGLERPWQQQPLPPQQTFPQQPPFSQQQQQQQQQPFPQQPSFSQQQPPFSQQQPILLQGPPFSQQTQPVLPQQSPFSQQQQLILPPQQQQQLPQQQISIVQPSILQQLNPCKVFLQQQCSPVVMPQRLARSQMWQQSSCHVMQQQCCQQLSQIPEQSRYDAIRAITYPIILQEQQQGFVQAQQQQPQQSDQGVSQSQQQSQQQLGQCSFQQPQQQLGQQPQQQQVQQGTFLQPHQIAHLEVMTSIALRTLPTMCSVNVPLYSSTTSVPFGVGTGVGAY
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide SQMWQQSSCHVMQQQCCQQLSQIPEQSR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops tauschii x Triticum turgidum | Aegilops tauschii x triticum turgidum | AAT76905 |
285950 |
| Triticum aestivum | Bread wheat | AGK83309 AFI81537 AGK83402 BAB78757 AGK83396 AGK83307 CAD58622 ACF93465 AGK83142 BAA22613 AGK83163 AGK83313 BAB78756 ANU06100 ACT98431 BAB78755 BAB78754 ACY08809 ACT98428 ACT98429 AGU91708 |
4565 |
| Triticum dicoccoides | Triticum dicoccoides | AID62117 AID62107 AID62098 |
85692 |
| Triticum durum | Durum wheat | CAA44473 CAC05403 |
4567 |
| Triticum monococcum | Triticum monococcum | ACJ76968 ACJ76969 |
4568 |
| Triticum monococcum subsp. aegilopoides | Triticum monococcum subsp. aegilopoides | ALG64890 |
52163 |
| Triticum monococcum subsp. monococcum | Triticum monococcum subsp. monococcum | ALG64892 |
408188 |
| Triticum turgidum | Triticum turgidum | ABV03150 |
4571 |
| Triticum urartu | Triticum urartu | AIR77104 AIR77106 AJD85699 |
4572 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.